Recombinant Pongo abelii Sphingolipid delta (4)-desaturase DES1 (DEGS1)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biochemical Activity

Sphingolipid delta(4)-desaturase DES1 catalyzes a critical reaction in sphingolipid metabolism - the introduction of a double bond at the C4-C5 position of dihydroceramide to form ceramide. This reaction represents the final step in the de novo synthesis pathway of ceramides, which are central molecules in sphingolipid metabolism and cellular signaling .

Catalytic Mechanism

The enzymatic reaction catalyzed by DEGS1 involves the following:

  1. Binding of dihydroceramide substrate to the enzyme's active site

  2. Coordination of oxygen by the iron center in the enzyme

  3. Abstraction of hydrogen atoms from the C4-C5 position of dihydroceramide

  4. Formation of a double bond between C4-C5, converting dihydroceramide to ceramide

This reaction can be represented as:

Dihydroceramide + O₂ + 2e⁻ → Ceramide + 2H₂O

The enzyme is classified with the EC number 1.14.-.- according to the available data, which indicates its role as an oxidoreductase acting on paired donors with incorporation of molecular oxygen .

Expression Systems and Production Methods

Recombinant Pongo abelii DEGS1 can be produced using various expression systems, with the choice of system influencing the protein's properties and functionality.

Expression Hosts

Based on the search results, recombinant Pongo abelii DEGS1 is produced using different expression systems:

  1. Cell-Free Expression systems - This appears to be a common method for producing the full-length protein with high purity (≥85%)

  2. Bacterial expression (E. coli)

  3. Yeast expression systems

  4. Baculovirus expression systems

  5. Mammalian cell expression systems

For partial protein expression, multiple host systems including E. coli, yeast, baculovirus, or mammalian cells can be employed .

Purification Methods

The purification process typically yields protein preparations with purity levels of 85% or higher, as determined by SDS-PAGE analysis . The purified protein is often stored in a Tris-based buffer containing 50% glycerol to maintain stability during storage at -20°C or -80°C for extended periods .

Biological Significance in Sphingolipid Metabolism

DEGS1 occupies a critical position in sphingolipid metabolism, which has far-reaching implications for various cellular processes and physiological functions.

Role in Sphingolipid Biosynthesis Pathway

In the sphingolipid biosynthesis pathway of Pongo abelii, DEGS1 functions alongside other enzymes including serine palmitoyltransferases, ceramide synthases, and ceramidases . The table below illustrates the position of DEGS1 in this pathway:

EnzymeFunction in PathwaySubstrateProduct
Serine Palmitoyltransferase (SPTLC1/2/3)Initial condensation reactionSerine + Palmitoyl-CoA3-ketosphinganine
3-Ketosphinganine Reductase (KDSR)Reduction3-ketosphinganineSphinganine
Ceramide Synthases (CERS1-6)N-acylationSphinganine + Acyl-CoADihydroceramide
DEGS1DesaturationDihydroceramideCeramide
Ceramidases (ASAH1/2, ACER1)DeacylationCeramideSphingosine

As shown in this pathway, DEGS1 catalyzes a crucial step that converts dihydroceramide to ceramide, which serves as a precursor for more complex sphingolipids and as a signaling molecule in its own right .

Signaling Functions of Ceramides

The product of DEGS1 activity, ceramide, is not merely an intermediate in sphingolipid synthesis but also functions as a bioactive lipid involved in numerous cellular processes including:

  1. Apoptosis regulation

  2. Cell cycle control

  3. Cellular differentiation

  4. Stress responses

  5. Membrane organization and dynamics

Research from Drosophila melanogaster has demonstrated that Delta4-desaturated sphingolipids provide essential early signals necessary for triggering entry into both meiotic and spermatid differentiation pathways during spermatogenesis . This suggests conserved signaling functions across different species, potentially including Pongo abelii.

Comparative Analysis with Human DEGS1

Pongo abelii DEGS1 shares significant sequence homology with human DEGS1, reflecting the close evolutionary relationship between humans and orangutans. This homology facilitates the use of the recombinant Pongo abelii protein as a model for understanding human sphingolipid metabolism.

Functional Equivalence

Studies have demonstrated that DEGS1 proteins from various species, including humans, mice, and Drosophila, can perform the same enzymatic function when expressed in yeast (Saccharomyces cerevisiae) . This functional conservation suggests that the Pongo abelii DEGS1 likely performs the same role in orangutan sphingolipid metabolism as its human counterpart does in humans.

Pathological Implications and Disease Associations

While the search results don't specifically address pathologies associated with Pongo abelii DEGS1, research on human DEGS1 provides valuable insights that may be applicable to the orangutan protein due to the high degree of conservation.

Role in Cancer Biology

Recent research has identified DES1 (the protein encoded by DEGS1) as a critical factor in cancer progression, particularly in promoting anchorage-independent survival (AIS) of cancer cells. DES1 has been shown to function as a downstream effector of HER2-driven glucose uptake and metabolism in breast cancer . Elevated DES1 levels are found in approximately one-third of HER2-positive breast cancers and are associated with worse survival outcomes .

Neurological Disorders

In humans, DEGS1 variants have been implicated in hypomyelinating leukodystrophies, a family of neurological disorders characterized by deficient myelination of the central nervous system . These pathogenic variants can either result in complete loss of enzyme function or reduce protein levels, both of which contribute to disease pathogenesis .

Research Applications and Experimental Uses

Recombinant Pongo abelii DEGS1 serves as a valuable tool for various research applications in biochemistry, molecular biology, and pharmacology.

Biochemical Assays and Enzymatic Studies

The recombinant protein can be used in enzymatic assays to study the catalytic properties of sphingolipid desaturases. Such assays typically involve:

  1. Incubation of the recombinant enzyme with dihydroceramide substrates

  2. Analysis of reaction products using liquid chromatography-mass spectrometry (LC-MS/MS)

  3. Determination of kinetic parameters such as Km, Vmax, and catalytic efficiency

These studies provide insights into the enzyme's substrate specificity, reaction mechanisms, and regulation .

Drug Discovery and Development

The recombinant protein can be utilized in screening assays to identify inhibitors or modulators of desaturase activity. Such compounds might have therapeutic potential in diseases where aberrant sphingolipid metabolism plays a role, such as cancer or neurological disorders . The availability of highly purified recombinant protein facilitates the development of high-throughput screening assays for drug discovery.

Research Applications

Commercial preparations of recombinant Pongo abelii DEGS1 may be used for:

  1. Enzyme activity assays

  2. Structural studies

  3. Development of inhibitors or activators

  4. Generation of antibodies

  5. Positive controls in expression studies

  6. Protein-protein interaction studies

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
DEGS1; DES1; Sphingolipid delta(4-desaturase DES1; Degenerative spermatocyte homolog 1; Dihydroceramide desaturase-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-323
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
DEGS1
Target Protein Sequence
GNRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLAAFYIV KDLDWKWVIFGAYAFGSCINHSMTLGIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYS VSFKSYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKP ITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHE TYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFV MDDTISPYSRMKRHQKGEMVLE
Uniprot No.

Target Background

Function
This protein exhibits sphingolipid-delta-4-desaturase activity. It converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine) and catalyzes the equilibrium isomerization of retinols.
Database Links
Protein Families
Fatty acid desaturase type 1 family, DEGS subfamily
Subcellular Location
Mitochondrion membrane. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the functional role of DEGS1 in sphingolipid metabolism?

DEGS1 (Dihydroceramide desaturase 1) catalyzes a critical reaction in the de novo synthesis pathway of ceramides by introducing a trans 4,5 double bond to dihydroceramide. This enzymatic conversion is essential for producing ceramide, which serves as a foundational molecule in sphingolipid metabolism . The conversion from dihydroceramide to ceramide represents a key regulatory point in cellular sphingolipid homeostasis, with significant implications for cell signaling, membrane structure, and various pathophysiological processes.

How can researchers assess DEGS1 enzymatic activity in experimental models?

To accurately assess DEGS1 enzymatic activity, researchers should employ metabolic labeling with deuterated palmitate followed by LC-MS/MS analysis. This technique allows for precise quantification of the ceramide/dihydroceramide and sphingomyelin/dihydrosphingomyelin ratios, which serve as direct indicators of DEGS1 activity . When establishing this methodology, it is important to:

  • Optimize incubation time with the deuterated substrate to ensure sufficient incorporation

  • Calibrate LC-MS/MS parameters specifically for distinguishing between saturated and unsaturated sphingolipid species

  • Include appropriate controls (such as known DEGS1 inhibitors) to validate assay sensitivity

  • Consider analyzing multiple sphingolipid classes to comprehensively assess the enzyme's activity

The ceramide/dihydroceramide ratio can be significantly affected by alterations in DEGS1 function and can be reversed by overexpression of wild-type DEGS1 in knockout models, making it a reliable marker for functional assessment .

What are the known disease-relevant variants of DEGS1 and their functional implications?

Several disease-relevant variants of DEGS1 have been identified, with varying effects on enzymatic function. The L175Q and N255S variants retain some functionality, as demonstrated by their ability to restore ceramide/dihydroceramide ratios when overexpressed in knockout cell models . In contrast, other variants show complete loss of function.

The N255S variant is particularly interesting as it presents a complex case. Despite showing residual enzymatic activity when measured at high substrate and homogenate protein concentrations in vitro, patient fibroblasts heterozygous for this variant display very low variant DEGS1 protein levels and significantly reduced ceramide/dihydroceramide ratios in metabolic labeling experiments . This suggests that both catalytic activity impairment and protein stability/expression level reduction contribute to disease pathogenesis.

Researchers investigating DEGS1 variants should therefore consider both enzymatic function and protein expression levels in their experimental design, as both mechanisms appear to be relevant in disease contexts.

How does polyubiquitination affect DEGS1 function and what are the implications for experimental design?

Polyubiquitination of DEGS1 represents a critical post-translational modification that can dramatically alter its functional profile. Research has demonstrated that certain compounds, including the sphingosine kinase inhibitor SKi and fenretinide, can induce DEGS1 polyubiquitination . This modification promotes a "gain of function" that enables activation of prosurvival pathways, including p38 MAPK, JNK, and XBP-1s .

When designing experiments to study DEGS1 function, researchers should:

  • Assess the ubiquitination status of DEGS1 under various experimental conditions

  • Consider the potential dual roles of DEGS1 in both cell survival and apoptotic pathways

  • Include controls to distinguish between effects mediated by catalytic activity versus those related to protein-protein interactions facilitated by polyubiquitination

  • Use targeted inhibitors that differentially affect ubiquitination (e.g., SKi versus ABC294640) to dissect specific mechanistic pathways

The opposing functions of DEGS1 in cell survival and apoptosis appear to be related to its polyubiquitination status . For example, the sphingosine kinase inhibitor ABC294640 increases de novo ceramide synthesis and induces apoptosis via a DEGS1-dependent mechanism without inducing polyubiquitination, in contrast to SKi, which induces polyubiquitination and promotes survival pathways .

What structural considerations should guide the design of selective DEGS1 inhibitors based on current knowledge?

Based on available data, effective inhibitor design should consider:

  • The cyclopropenone ceramide scaffold, exemplified by PR280, which has demonstrated superior inhibition (IC50 = 700 nM) compared to reference inhibitors GT11 and XM462

  • Key ligand-enzyme interactions identified through docking studies with the AlphaFold2-predicted structure

  • Rigid scaffold incorporation into ceramide-based compounds, which appears to enhance inhibitory potency

How can metabolic labeling techniques be optimized for accurate assessment of DEGS1 activity in primary cell cultures?

Metabolic labeling represents the gold standard for assessing DEGS1 activity in cellular systems. When adapting these techniques for primary cell cultures, including those derived from Pongo abelii, researchers should consider the following methodological optimizations:

  • Substrate selection and concentration: Deuterated palmitate is commonly used, but the concentration must be carefully titrated to avoid toxicity while ensuring sufficient incorporation into sphingolipid pathways .

  • Incubation time optimization: Primary cells may have different metabolic rates compared to established cell lines. Time course experiments (typically ranging from 2-24 hours) should be conducted to determine optimal labeling periods.

  • Sample preparation protocol: Consider the following pipeline:

    • Gentle cell lysis to preserve membrane integrity

    • Lipid extraction using a modified Bligh and Dyer method

    • Phase separation and collection of the organic phase

    • Concentration under nitrogen stream

    • Reconstitution in appropriate LC-MS/MS solvent

  • Analytical considerations: LC-MS/MS methods should be specifically calibrated to distinguish between saturated and unsaturated sphingolipid species with similar mass/charge ratios. Multiple reaction monitoring (MRM) transitions should be established for key sphingolipid species.

  • Data normalization: Results should be normalized to total cellular protein or to non-labeled sphingolipid species to account for differences in cell number and extraction efficiency.

The ceramide/dihydroceramide ratio serves as a primary readout but should be complemented by analysis of sphingomyelin/dihydrosphingomyelin ratios for comprehensive activity assessment .

What methodological approaches can resolve contradictory data regarding DEGS1's role in apoptosis versus cell survival?

The contradictory findings regarding DEGS1's role in promoting either cell survival or apoptosis can be addressed through carefully designed experiments that consider the protein's post-translational modifications and interaction partners. Based on current evidence, the polyubiquitination status of DEGS1 appears to be a critical determinant of its functional outcome .

To resolve contradictory data, researchers should:

  • Assess polyubiquitination status: Use immunoprecipitation followed by Western blotting with anti-ubiquitin antibodies to determine DEGS1's ubiquitination state under various experimental conditions.

  • Employ selective inhibitor panels: Compare the effects of inhibitors that induce polyubiquitination (e.g., SKi, fenretinide) with those that do not (e.g., ABC294640) at concentrations that produce comparable inhibition of enzymatic activity .

  • Monitor pathway activation: Simultaneously assess activation of both pro-survival (p38 MAPK, JNK, XBP-1s) and pro-apoptotic pathways to determine the predominant cellular response.

  • Use genetic approaches: Employ CRISPR/Cas9 to generate DEGS1 variants that are resistant to ubiquitination but retain catalytic function to dissect the contribution of each function.

  • Temporal analysis: Conduct time-course experiments to determine whether DEGS1 elicits different responses at different time points following stimulation.

By systematically addressing these aspects, researchers can clarify the context-dependent roles of DEGS1 in cell fate determination.

What are the optimal expression systems for producing recombinant Pongo abelii DEGS1?

When expressing recombinant Pongo abelii DEGS1, researchers should consider several expression systems depending on the experimental goals:

  • Mammalian expression systems (HEK293, CHO):

    • Provide proper post-translational modifications

    • Enable assessment of polyubiquitination

    • Suitable for functional studies requiring native-like protein processing

    • Allow for complementation studies in DEGS1 knockout backgrounds

  • Insect cell systems (Sf9, Hi5):

    • Higher protein yield than mammalian systems

    • Maintain most post-translational modifications

    • Useful for structural studies requiring larger protein quantities

  • Bacterial systems (E. coli):

    • Highest yield but lack post-translational modifications

    • Suitable for production of protein fragments for antibody generation

    • Require refolding protocols for this membrane protein

For expression validation, Western blotting can confirm protein production, while metabolic labeling with deuterated palmitate followed by LC-MS/MS analysis of ceramide/dihydroceramide ratios can verify functional activity .

How can researchers effectively analyze contradictory data when studying DEGS1 variants?

Analysis of contradictory data is a common challenge when studying DEGS1 variants, particularly when biochemical assays and cellular phenotypes present divergent results. To effectively address such discrepancies, consider the following methodological approach:

  • Distinguish between in vitro activity and cellular functionality:

    • Some DEGS1 variants (like N255S) show residual activity in high-concentration biochemical assays but minimal function in cellular contexts due to low protein levels

    • Perform both direct enzymatic assays and cellular metabolic labeling experiments

  • Implement a systematic variant analysis pipeline:

    • Assess enzymatic activity using recombinant protein

    • Determine protein expression/stability in cellular systems

    • Measure functional outcomes through sphingolipid profiling

    • Document subcellular localization pattern

  • Utilize complementation studies:

    • Express variants in DEGS1-knockout backgrounds

    • Quantify restoration of ceramide/dihydroceramide ratios

    • Compare with wild-type DEGS1 complementation

  • Data integration frameworks:

    • Create truth tables documenting variant performance across multiple assays

    • Weight evidence based on assay relevance to physiological function

    • Consider both loss of function and reduced protein levels as disease mechanisms

DEGS1 VariantIn Vitro ActivityProtein ExpressionComplementationDisease Relevance
Wild-typeHighNormalCompleteReference
L175QModerateNormalPartialPathogenic
N255SLow-ModerateVery lowMinimalPathogenic
Other variantsNegligibleVariableNonePathogenic

What considerations should guide the development of cell-based assays for DEGS1 inhibitor screening?

When developing cell-based assays for DEGS1 inhibitor screening, researchers should address several critical parameters to ensure robust and physiologically relevant results:

  • Cell line selection:

    • Use cells with documented DEGS1 dependency (primary cells, patient-derived cells)

    • Consider species-specific differences when testing inhibitors for Pongo abelii DEGS1

    • Include negative control cell lines with DEGS1 knockout for specificity assessment

  • Assay endpoint selection:

    • Primary endpoints: ceramide/dihydroceramide ratio; sphingomyelin/dihydrosphingomyelin ratio

    • Secondary endpoints: cell viability, apoptosis markers, activation of survival pathways

    • Consider temporal dynamics with early (4-8h) and late (24-48h) measurements

  • Controls and validation:

    • Include reference inhibitors (GT11, XM462, PR280) at established concentrations

    • Use genetic manipulation (siRNA, CRISPR) to validate target specificity

    • Implement dose-response curves to determine IC50 values

  • Technical considerations:

    • Optimize cell density and treatment duration

    • Standardize lipid extraction and LC-MS/MS analysis protocols

    • Implement quality control measures (Z′-factor calculation, signal-to-background ratio)

  • Data analysis framework:

    • Normalize inhibition to positive controls

    • Consider off-target effects through broader lipidomic profiling

    • Validate hits through orthogonal assays and structural analogs

The cyclopropenone ceramide PR280, with its IC50 of 700 nM, provides an excellent positive control for assay validation, as it demonstrates superior inhibition compared to previously established reference compounds .

How can AlphaFold2 predictions enhance understanding of DEGS1 structure-function relationships?

The recent application of AlphaFold2 to predict the 3D structure of DEGS1 has opened new avenues for understanding structure-function relationships in this enzyme . Researchers can leverage these computational predictions by:

  • Structural analysis of functional domains:

    • Identify catalytic residues responsible for the desaturation reaction

    • Map disease-associated variants onto the predicted structure

    • Analyze membrane topology and substrate binding pockets

  • Docking studies for inhibitor design:

    • Use the AlphaFold2-predicted structure to conduct virtual screening campaigns

    • Evaluate binding modes of known inhibitors (GT11, XM462, PR280)

    • Identify key ligand-enzyme interactions that contribute to inhibitory potency

  • Structure-guided mutagenesis:

    • Design targeted mutations to test hypotheses about residue functionality

    • Create variants with altered substrate specificity or inhibitor sensitivity

    • Validate predictions through enzymatic assays with recombinant protein

  • Comparative analysis with related enzymes:

    • Align predicted structure with other desaturases and oxidoreductases

    • Identify conserved structural features across evolutionary space

    • Extrapolate function based on structural homology

The AlphaFold2 prediction has been particularly valuable for DEGS1 given the previous lack of a crystalline structure for this enzyme or close homologues, which had hampered detailed understanding of its inhibition mechanism and rational inhibitor design .

What strategies can resolve technical challenges in analyzing dihydroceramide/ceramide ratios in complex biological samples?

Accurate quantification of dihydroceramide/ceramide ratios in complex biological samples presents several technical challenges. Researchers can implement the following strategies to enhance analytical rigor:

  • Sample preparation optimization:

    • Implement phase separation techniques to minimize matrix effects

    • Use internal standards for each major sphingolipid class

    • Consider subcellular fractionation to assess compartment-specific changes

  • Analytical method enhancement:

    • Develop specific MRM transitions for dihydroceramide and ceramide species

    • Implement chromatographic separation that resolves species differing only by a double bond

    • Consider derivatization approaches to enhance ionization efficiency

  • Data normalization strategies:

    • Normalize to total phospholipid content rather than just protein

    • Use deuterated internal standards matched to the endogenous species

    • Implement quality control samples across analytical batches

  • Method validation parameters:

    • Determine lower limits of quantification for key sphingolipid species

    • Assess matrix effects through standard addition experiments

    • Document repeatability and reproducibility with coefficient of variation targets

  • Advanced data analysis:

    • Apply multivariate statistical approaches to elucidate patterns

    • Consider ratios across multiple sphingolipid classes (ceramides, sphingomyelins)

    • Implement computational deconvolution for overlapping signals

Metabolic labeling with deuterated palmitate provides a particularly powerful approach, as it allows tracking of newly synthesized sphingolipids and calculation of ceramide/dihydroceramide ratios as a direct measure of DEGS1 activity in cellular systems .

How can DEGS1 inhibition strategies be optimized for disease models relevant to Pongo abelii physiology?

When developing DEGS1 inhibition strategies for disease models relevant to Pongo abelii physiology, researchers should consider several specialized approaches:

  • Species-specific considerations:

    • Sequence comparisons between human and Pongo abelii DEGS1 to identify potential structural differences

    • Validate inhibitor efficacy specifically against recombinant Pongo abelii DEGS1

    • Consider evolutionary conservation of regulatory pathways

  • Disease model selection:

    • Develop cell cultures from Pongo abelii specimens when ethically obtainable

    • Consider fibroblast cultures, which have been effectively used in DEGS1 studies

    • Implement organoid models for tissue-specific effects

  • Inhibitor delivery optimization:

    • Assess species-specific pharmacokinetics for lead compounds

    • Consider biodistribution to target tissues

    • Optimize dosing regimens based on pilot studies

  • Combination approaches:

    • Test DEGS1 inhibitors in combination with other pathway modulators

    • Consider differential effects on polyubiquitination status

    • Monitor ceramide/dihydroceramide ratios as a biomarker of target engagement

  • Endpoint assessment:

    • Implement sphingolipidomic profiling to comprehensively assess pathway modulation

    • Monitor both intended target effects and potential compensatory mechanisms

    • Consider long-term versus acute effects on cellular homeostasis

The novel inhibitor PR280, with its superior potency (IC50 = 700 nM) compared to reference compounds , provides a promising chemical tool for such studies, although species-specific validation would be required.

What are the key considerations when interpreting contradictory data on DEGS1 function across different experimental systems?

Interpreting contradictory data on DEGS1 function across different experimental systems requires a systematic approach that accounts for various technical and biological factors:

  • System-specific context evaluation:

    • Document differences in cellular background (enzyme expression levels, pathway activity)

    • Consider post-translational modifications, particularly polyubiquitination status

    • Assess metabolic state differences that might influence substrate availability

  • Methodological standardization:

    • Implement consistent protocols for activity measurement

    • Standardize lipid extraction and analytical methods

    • Use identical inhibitor concentrations and exposure times

  • Comprehensive data collection framework:

    • Measure multiple endpoints beyond simple enzyme activity

    • Document both upstream regulators and downstream effectors

    • Consider temporal dynamics of responses

  • Integrated data analysis:

    • Implement multivariate statistical approaches to identify patterns

    • Develop computational models that incorporate context-dependent variables

    • Weight evidence based on methodological rigor

Experimental SystemMeasured ActivityPolyubiquitination StatusObserved Cellular OutcomePotential Explanation
System AInhibitedInducedCell survivalGain of function via polyubiquitination
System BInhibitedNot inducedApoptosisLoss of enzymatic function without compensatory mechanisms
System CVariableContext-dependentMixedSystem-specific regulatory networks

This structured approach can help reconcile seemingly contradictory observations by identifying the specific cellular context in which each outcome predominates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.