Recombinant Pongo abelii Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

What is the molecular composition and function of SDHD in mitochondrial metabolism?

SDHD functions as the small subunit D of the succinate dehydrogenase complex, serving as an integral membrane protein within the mitochondria. It forms part of complex II in the electron transport chain, contributing to both the tricarboxylic acid cycle and oxidative phosphorylation pathways. The protein consists of 159 amino acids with the functional expression region spanning positions 57-159 . In Pongo abelii (Sumatran orangutan), SDHD participates in electron transfer from succinate to ubiquinone, supporting cellular energy production through the conversion of succinate to fumarate while reducing FAD to FADH₂.

The protein sequence for Pongo abelii SDHD includes: SGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAATLTLHGHWGLGQVVTDYVHGDASQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAWLWKL . This sequence contains hydrophobic regions consistent with its membrane-anchoring function, which is critical for the proper assembly and activity of the succinate dehydrogenase complex.

How does Pongo abelii SDHD structure compare with human SDHD, and what are the implications for cross-species research?

While the search results don't provide direct structural comparisons, comparative analysis of the Pongo abelii SDHD (UniProt: Q5RC29) reveals high sequence homology with human SDHD. This conservation reflects the evolutionary importance of succinate dehydrogenase function across mammalian species. Researchers should note that despite this similarity, species-specific differences may affect antibody recognition, protein-protein interactions, and regulatory mechanisms.

For cross-species studies, it's advisable to align sequences and identify conserved domains before designing experiments. When using Pongo abelii SDHD as a model for human studies, researchers should validate functional equivalence through complementation assays or comparative activity measurements to ensure translational relevance.

What experimental approaches are recommended for studying SDHD integration into the succinate dehydrogenase complex?

To study SDHD integration into the succinate dehydrogenase complex, researchers should consider:

• Co-immunoprecipitation assays: Using antibodies against SDHD or other complex II components to pull down the intact complex, followed by Western blot analysis to confirm interactions.

• Blue native PAGE: This technique preserves native protein complexes during electrophoresis, allowing visualization of intact succinate dehydrogenase complex and assessment of SDHD incorporation.

• Proximity labeling methods: BioID or APEX2 fusion proteins can identify proteins in close proximity to SDHD within the mitochondrial membrane.

• Sucrose gradient ultracentrifugation: This can separate intact complexes based on size and density, with subsequent immunoblotting to detect SDHD within complex II fractions.

When performing these experiments, use mitochondrial isolation buffers containing mild detergents (0.5-1% digitonin or 0.1% DDM) to maintain complex integrity while solubilizing membrane proteins.

What are the optimal expression systems for producing functional recombinant Pongo abelii SDHD?

For functional expression of recombinant Pongo abelii SDHD, consider these methodological approaches:

Expression Systems Comparison:

For membrane proteins like SDHD, cell-free expression systems supplemented with lipid nanodiscs or detergent micelles may improve folding and solubility. Regardless of the system chosen, expression should be verified through Western blotting and activity assays to confirm functionality.

What purification strategies maximize yield and activity of recombinant SDHD?

Purification of recombinant SDHD requires careful consideration of its membrane-associated nature. The following stepwise approach is recommended:

• Membrane isolation: Differential centrifugation followed by sucrose gradient purification of membrane fractions.

• Solubilization: Use mild detergents (0.5-1% DDM, CHAPS, or digitonin) in buffers containing 10-20% glycerol to stabilize the protein during extraction .

• Affinity chromatography: If expressed with a tag (His, FLAG, etc.), use corresponding affinity resins. Include detergent at concentrations above the critical micelle concentration in all buffers.

• Size exclusion chromatography: For final polishing and buffer exchange into storage buffer containing 50% glycerol for stability .

Monitor protein purity using SDS-PAGE and activity using succinate:ubiquinone oxidoreductase assays at each purification stage. The final product should be stored at -20°C for routine use or -80°C for extended storage to prevent activity loss .

How can researchers assess and maintain the functional integrity of purified SDHD?

To assess and maintain functional integrity:

• Enzymatic activity assays: Measure electron transfer from succinate to artificial electron acceptors (DCPIP, MTT) or direct ubiquinone reduction using spectrophotometric methods.

• Thermal shift assays: Monitor protein stability under various buffer conditions to identify optimal stabilization parameters.

• Circular dichroism: Verify secondary structure integrity, particularly important when comparing wild-type to mutant proteins.

• Storage optimization: Store in Tris-based buffer with 50% glycerol at -20°C, avoiding repeated freeze-thaw cycles . For working experiments, maintain aliquots at 4°C for up to one week.

• Quality control testing: Periodically retest activity of stored proteins to establish decay curves under various storage conditions.

Researchers should note that membrane proteins like SDHD are particularly susceptible to denaturation during purification and storage. Regular validation of functionality is essential before experimental use.

What are the methodological considerations for using recombinant SDHD in complex II activity assays?

When designing complex II activity assays using recombinant SDHD, researchers should consider:

• Reconstitution requirements: SDHD alone is not enzymatically active; it must be incorporated with other SDH subunits (SDHA, SDHB, SDHC) to form functional complex II.

• Assay buffer composition: Use 50 mM phosphate buffer (pH 7.4) containing 10 mM succinate as substrate, with appropriate electron acceptors (ubiquinone, DCPIP, or MTT).

• Detection methods:

  • Spectrophotometric monitoring of DCPIP reduction (λ = 600 nm)

  • Measurement of succinate-dependent oxygen consumption using oxygen electrodes

  • Direct tracking of ubiquinone reduction (λ = 275 nm)

• Controls and validation:

  • Include malonate (competitive inhibitor) as negative control

  • Compare activity to commercially available SDH standards

  • Normalize activity to protein concentration

• Temperature and pH optimization: While mammalian SDH typically functions optimally at 37°C and pH 7.2-7.4, species-specific variations may exist for Pongo abelii SDHD that should be empirically determined.

How can recombinant SDHD be effectively used in protein-protein interaction studies?

For protein-protein interaction studies involving SDHD:

• Pull-down assays: Use tagged recombinant SDHD as bait protein with cell lysates or purified potential interactors, followed by SDS-PAGE and immunoblotting or mass spectrometry.

• Surface plasmon resonance (SPR): Immobilize SDHD on sensor chips to measure binding kinetics with other complex II components or regulatory proteins.

• AP-MS/MS approaches: As demonstrated in the research on SDHD promoter mutations, affinity purification coupled with mass spectrometry can identify specific protein interactions . This approach successfully identified GABPA and GABPB1 as transcription factors interacting with the SDHD promoter region.

• Yeast two-hybrid with membrane protein adaptations: Modified membrane yeast two-hybrid systems can be used to screen for SDHD interactors.

• FRET/BRET assays: For studying interactions in live cells, fusion constructs with fluorescent or bioluminescent proteins can detect proximity-based energy transfer.

When conducting these experiments, researchers should account for the membrane-associated nature of SDHD by including appropriate detergents in buffers and considering native lipid environments for more physiologically relevant results.

What protocols are recommended for investigating SDHD mutations and their functional consequences?

To investigate SDHD mutations and their functional consequences, researchers should implement a comprehensive workflow:

• Mutation identification and validation:

  • PCR amplification and Sanger sequencing of the SDHD coding region and promoter

  • Use of bam-readcount for analyzing next-generation sequencing data with appropriate filtering criteria (depth > 6, alternative base count > 2, mapping quality > 20)

• In silico analysis:

  • Employ tools like motifbreakR with HOCOMOCO transcription factor binding site models to predict effects on transcription factor binding

  • Assess evolutionary conservation across species

  • Model structural impacts using protein prediction software

• Reporter assays:

  • Construct luciferase reporters containing wild-type and mutant SDHD promoter sequences to assess transcriptional impact

  • Measure expression changes under various conditions or in different cell types

• DNA-protein interaction assays:

  • Perform electrophoretic mobility shift assays (EMSA) to assess transcription factor binding to wild-type versus mutant sequences, as demonstrated with GABPA/B1 binding to the SDHD promoter

  • Conduct quantitative mass spectrometry of DNA pulldowns to identify proteins differentially binding to wild-type versus mutant sequences

• Functional validation:

  • Use siRNA knockdown to confirm the role of specific transcription factors in regulating SDHD expression

  • Measure SDH enzyme activity in cells harboring wild-type versus mutant SDHD

  • Assess cellular phenotypes including growth, metabolism, and response to stressors

This approach has been successfully applied to identify GABPA and GABPB1 as key transcription factors regulating SDHD expression, with their binding disrupted by recurrent promoter mutations in melanoma .

How does SDHD contribute to tumor development, and what experimental models best recapitulate these mechanisms?

SDHD's role in tumor development is linked to its function in cellular metabolism and gene regulation:

• Metabolic reprogramming: SDHD mutations lead to succinate accumulation, which inhibits α-ketoglutarate-dependent dioxygenases including TET enzymes and HIF prolyl hydroxylases, resulting in pseudohypoxia and epigenetic alterations.

• Transcriptional dysregulation: SDHD promoter mutations, particularly in melanoma, disrupt binding of ETS transcription factors like GABPA and GABPB1, leading to reduced SDHD expression . These mutations occur at a frequency of 4-5% across melanoma samples and correlate with poor prognosis .

• Clinical significance: Approximately 20% of patients with phaeochromocytoma or paraganglioma carry germline mutations in SDHx genes (including SDHD) . These patients require specialized screening and follow-up protocols developed through international consensus .

Recommended experimental models include:

When studying SDHD promoter mutations, researchers should utilize luciferase reporter assays, DNA-protein interaction studies, and transcriptional profiling to elucidate the consequences of disrupted ETS factor binding .

What methodologies are most effective for studying SDHD in the context of phaeochromocytoma and paraganglioma?

For studying SDHD in phaeochromocytoma and paraganglioma contexts:

• Genetic screening approaches:

  • Next-generation sequencing panels targeting all SDHx genes

  • MLPA (Multiplex Ligation-dependent Probe Amplification) to detect large deletions/duplications

  • Analysis of both germline and somatic mutations

• Functional assessments:

  • SDH enzyme activity measurements in tumor tissue

  • Immunohistochemistry for SDHB (loss of SDHB staining is a surrogate marker for dysfunction of any SDH subunit)

  • Metabolomic profiling to detect succinate accumulation and metabolic alterations

• Clinical correlation studies:

  • Comprehensive phenotyping of patients with SDHD mutations

  • Correlation of mutation types with clinical presentation and outcomes

  • Implementation of international consensus surveillance protocols for affected individuals and carriers

• Translational research approaches:

  • Development of metabolic-targeted therapies exploiting SDH deficiency

  • Identification of synthetic lethal interactions in SDHD-mutant tumors

  • Investigation of hypermethylated genes as therapeutic targets

Researchers working with patient samples should follow the international consensus on initial screening and follow-up for individuals with SDHx mutations, which includes comprehensive clinical, biochemical, and imaging protocols .

What techniques can detect aberrant SDHD promoter binding by transcription factors in cancer samples?

To detect aberrant transcription factor binding to the SDHD promoter:

• Chromatin immunoprecipitation (ChIP):

  • Perform ChIP using antibodies against ETS transcription factors (particularly GABPA and GABPB1)

  • Compare binding in wild-type versus mutant promoter samples

  • Combine with qPCR or sequencing (ChIP-seq) for quantitative analysis

• Electrophoretic mobility shift assays (EMSA):

  • Design probes containing wild-type or mutant promoter sequences

  • Incubate with nuclear extracts or recombinant transcription factors

  • Visualize differential binding patterns, as demonstrated with GABPA/B1 binding to wild-type but not mutant SDHD promoter sequences

• DNA pulldown with mass spectrometry:

  • Use biotinylated DNA oligonucleotides containing wild-type or mutant sequences

  • Perform affinity purification followed by quantitative mass spectrometry

  • This approach successfully identified GABPA and GABPB1 as wild-type-specific interactors at the C523T and C524T mutation sites

• Reporter assays:

  • Create luciferase constructs with wild-type or mutant SDHD promoters

  • Measure differential reporter expression in relevant cell types

  • Test the effect of transcription factor overexpression or knockdown

• CRISPR-based approaches:

  • Use CRISPR interference (CRISPRi) to block transcription factor binding sites

  • Apply CRISPR activation (CRISPRa) to enhance recruitment of transcription factors

  • Create isogenic cell lines with specific promoter mutations

These methods have confirmed that recurrent SDHD promoter mutations (particularly C523T and C524T) disrupt GABPA/GABPB1 binding, contributing to reduced SDHD expression in melanoma .

How can researchers utilize recombinant SDHD to study mitochondrial complex assembly?

To study mitochondrial complex assembly using recombinant SDHD:

• In vitro reconstitution systems:

  • Purify all four SDH subunits (SDHA, SDHB, SDHC, SDHD) individually

  • Combine in controlled conditions with necessary cofactors

  • Monitor assembly using native PAGE, analytical ultracentrifugation, or cryo-EM

  • Test the impact of mutations on assembly efficiency and stability

• Import assays with isolated mitochondria:

  • Express radiolabeled or fluorescently tagged SDHD

  • Incubate with isolated mitochondria under various conditions

  • Track import efficiency, membrane insertion, and complex formation

  • Use cross-linking to capture assembly intermediates

• Time-resolved proteomics:

  • Pulse-chase labeling of newly synthesized SDHD

  • Immunoprecipitation at different time points

  • Mass spectrometry analysis of co-precipitating proteins

  • Identification of assembly factors and chaperones

• Structural biology approaches:

  • Apply hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Use single-particle cryo-EM to visualize assembly intermediates

  • Perform cross-linking mass spectrometry to identify proximity relationships

When designing these experiments, researchers should consider the membrane environment, as SDHD is an integral membrane protein requiring appropriate lipid composition for proper folding and function .

What approaches can be used to study evolutionary conservation of SDHD across primate species?

To investigate evolutionary conservation of SDHD across primates:

• Comparative sequence analysis:

  • Align SDHD sequences from various primate species including Pongo abelii

  • Calculate sequence conservation scores across functional domains

  • Identify sites under positive or negative selection using dN/dS ratios

  • Map conservation onto structural models to identify functionally critical regions

• Promoter evolution studies:

  • Compare transcription factor binding sites across species

  • Identify conserved regulatory elements using phylogenetic footprinting

  • Test cross-species promoter activity in reporter assays

• Functional complementation:

  • Express SDHD from different primate species in SDHD-deficient cell lines

  • Measure restoration of complex II activity

  • Assess interspecies compatibility of SDHD with other SDH subunits

• Structural conservation analysis:

  • Generate homology models of SDHD across species

  • Compare predicted protein-protein interaction interfaces

  • Assess conservation of post-translational modification sites

This evolutionary perspective can provide insights into functionally critical regions of SDHD that have been conserved through primate evolution, potentially highlighting domains essential for protein function that should be prioritized in functional studies.

How can researchers develop high-throughput screening assays using recombinant SDHD for drug discovery?

For high-throughput screening applications:

• Activity-based screening platforms:

  • Develop miniaturized SDH activity assays in 384- or 1536-well formats

  • Optimize colorimetric or fluorometric readouts for automated detection

  • Include positive controls (known inhibitors like thenoyltrifluoroacetone) and negative controls

• Binding assays:

  • Utilize thermal shift assays to detect compound binding

  • Develop fluorescence polarization assays with labeled SDHD or interacting partners

  • Implement surface plasmon resonance screening for fragment-based approaches

• Cell-based functional screens:

  • Generate reporter cell lines where SDHD function is linked to fluorescent or luminescent readouts

  • Develop assays measuring mitochondrial membrane potential or oxygen consumption

  • Create systems to detect rescue of SDHD-deficient phenotypes

• In silico screening combined with validation:

  • Perform virtual screening against SDHD or SDH complex structural models

  • Validate top hits using biochemical and cellular assays

  • Optimize lead compounds through medicinal chemistry approaches

• Target validation strategies:

  • Confirm on-target effects using CRISPR-engineered resistant mutants

  • Perform cellular thermal shift assays (CETSA) to verify target engagement

  • Conduct metabolomic profiling to confirm impact on succinate metabolism

These approaches can identify compounds that modulate SDHD function, potentially leading to therapeutic strategies for SDH-deficient tumors or tools to study SDHD function in cellular systems.