Recombinant Pongo abelii Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
ST7
Target Protein Sequence
MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRHWNCKSIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Database Links
Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ST7 protein and what is its function in primate biology?

ST7 (Suppression of Tumorigenicity 7) is a protein encoded by the ST7 gene located on chromosome 7 in both humans and Sumatran orangutans (Pongo abelii) . In humans, ST7 is considered a candidate tumor suppressor gene at chromosome locus 7q31.1 . The protein's function appears to be conserved across primates, with evidence suggesting its involvement in tumor suppression pathways. Research has shown that when introduced into cancer cell lines, ST7 can suppress in vivo tumorigenicity .

Multiple lines of evidence support ST7's role as a tumor suppressor:

  • Loss of heterozygosity (LOH) for 7q microsatellite DNA markers is common in many human tumor types

  • Cytogenetic analyses show frequent deletions within 7q in various cancers

  • Functional complementation assays demonstrate that microcell fusion of an intact chromosome 7 into cancer cell lines with LOH at 7q31 inhibits tumorigenicity

While the exact molecular mechanism remains under investigation, ST7's conservation across primates suggests an evolutionarily important function in cellular regulation.

How does Pongo abelii ST7 protein structure compare to human ST7?

The Pongo abelii ST7 protein shares significant homology with human ST7. According to the available amino acid sequence data, Pongo abelii ST7 contains 585 amino acids . Key structural features include:

  • Multiple transmembrane domains

  • Conserved functional motifs found in tumor suppressor proteins

  • Regions with high sequence conservation across primates

The amino acid sequence available for Pongo abelii ST7 (Q2IBE0) indicates high conservation in functional domains compared to human ST7 . This conservation suggests similar physiological roles between the species, making Pongo abelii ST7 a valuable research model for understanding human ST7 function.

What expression patterns have been observed for ST7 in tissue samples?

While specific expression data for Pongo abelii ST7 is limited, human ST7 expression studies can provide insight into likely expression patterns. In humans, ST7 is expressed across multiple tissue types with varying intensity . Expression has been detected in:

  • Brain tissues (hippocampal formation, cerebral cortex)

  • Endocrine tissues (thyroid, adrenal gland)

  • Digestive system (liver, pancreas, colon)

  • Reproductive tissues

  • Lymphoid tissues

The broad expression pattern suggests ST7 may have tissue-specific functions beyond its tumor suppressor role. Researchers working with Pongo abelii ST7 should consider these expression patterns when designing experiments to evaluate physiological relevance.

What are effective strategies for recombinant expression and purification of Pongo abelii ST7?

Based on research approaches with similar proteins, the following methodological approach is recommended:

Expression System Selection:

  • E. coli: Suitable for individual domains but may present challenges for full-length protein due to transmembrane regions

  • Mammalian cells (HEK293): Preferred for full-length protein with proper folding and post-translational modifications

Expression Optimization Strategies:

  • Consider adding zinc supplementation during expression, as this has shown to increase yield in similar proteins (as demonstrated with MORC4 protein)

  • Test multiple fragments/domains separately if full-length expression proves challenging

  • Use codon optimization for the expression system

Purification Protocol:

  • Initial capture: Ni-IMAC for His-tagged constructs

  • TEV protease cleavage for tag removal

  • Ion exchange chromatography (consider both cation and anion exchange)

  • Size exclusion chromatography for final polishing

Quality Control:

  • SDS-PAGE analysis for purity assessment

  • Western blotting with anti-ST7 antibodies

  • Mass spectrometry for identity confirmation

How can researchers verify the functional activity of recombinant Pongo abelii ST7?

Functional verification of recombinant ST7 requires multiple approaches:

Binding Assays:

  • Identify potential binding partners through co-immunoprecipitation

  • Verify protein-protein interactions using analytical techniques such as SEC-MALLS (Size Exclusion Chromatography-Multi-Angle Laser Light Scattering)

Cell-Based Functional Assays:

  • Transfection studies in cancer cell lines to assess tumor suppression activity

  • Cell proliferation assays to measure growth inhibition

  • Colony formation assays to evaluate anchorage-independent growth suppression

Comparative Analysis:

  • Parallel testing with human ST7 to establish functional equivalence

  • Domain-specific functional assays to map activity to protein regions

What are the appropriate experimental controls when working with recombinant Pongo abelii ST7?

Proper experimental design requires rigorous controls:

Positive Controls:

  • Human ST7 protein (if available)

  • Well-characterized tumor suppressor proteins (e.g., p53, PTEN)

  • Active site mutants that retain structure but lack function

Negative Controls:

  • Empty vector controls for expression studies

  • Inactive mutant versions (site-directed mutagenesis of key residues)

  • Unrelated proteins of similar size/structure

Technical Controls:

  • Inclusion of standard curves for quantitative assays

  • Multiple biological and technical replicates

  • Randomization and blinding where applicable

How can comparative studies between human and Pongo abelii ST7 inform cancer research?

Comparative studies between human and Pongo abelii ST7 offer unique insights into cancer biology:

Evolutionary Conservation Analysis:

  • Identification of highly conserved domains likely essential for tumor suppression

  • Recognition of species-specific variations that may correlate with cancer susceptibility differences

Functional Divergence Studies:

  • Investigation of potential functional differences in tumor suppression mechanisms

  • Analysis of whether Pongo abelii ST7 can complement human ST7 deficiency in cancer models

Biomarker Development:

  • Assessment of whether conserved epitopes could serve as diagnostic markers

  • Development of antibodies targeting conserved regions for cancer detection

Given the rarity of mutations in human ST7 in some studies (only one missense change found in a breast cancer cell line) but reported frameshift mutations in others , comparative studies may help resolve contradictions regarding ST7's role in tumorigenesis.

What methods are recommended for investigating ST7 mutations in cancer models?

Based on previous research approaches, investigators should consider:

Mutation Screening Techniques:

  • PCR-SSCP (Polymerase Chain Reaction–Single-Strand Conformational Polymorphism) analysis for mutation detection

  • Direct DNA sequencing of the entire coding sequence

  • Next-generation sequencing for comprehensive variant detection

Study Design Considerations:

  • Include both primary tumor samples and cell lines

  • Analyze paired normal tissue to distinguish somatic from germline mutations

  • Screen multiple cancer types (research has examined colorectal, gastric, hepatocellular carcinomas)

Analytical Approaches:

  • Categorize mutations by type (frameshift, missense, silent)

  • Map mutations to functional domains

  • Correlate mutations with clinical outcomes

Previous studies have found contradictory results regarding ST7 mutations in cancers, with some reporting frequent frameshift mutations and others finding mutations to be extremely rare . This suggests the need for rigorous methodology and appropriate controls.

How might post-translational modifications of Pongo abelii ST7 influence its function?

Post-translational modifications (PTMs) can significantly impact protein function:

Potential PTMs to Investigate:

  • Phosphorylation: May regulate ST7 activity or protein-protein interactions

  • Ubiquitination: Could control protein stability and turnover

  • Glycosylation: Might affect protein folding, stability, or localization

Methodological Approaches:

  • Mass spectrometry to identify and map PTMs

  • Site-directed mutagenesis of modified residues to assess functional impact

  • Comparative PTM analysis between human and Pongo abelii ST7 to identify conserved modifications

Functional Implications:

  • PTMs may regulate ST7's tumor suppressor activity

  • Species differences in PTMs could explain functional variations

  • PTM patterns might change in disease states

How should researchers address contradictory findings regarding ST7's role in tumorigenesis?

The literature contains conflicting reports about ST7's importance as a tumor suppressor gene:

Contradictory Findings:

  • Some studies report frequent frameshift mutations in primary cancers and cell lines

  • Other studies found somatic mutations to be extremely rare or absent in primary tumors

  • One study detected only three somatic mutations (near exon-intron junction in intron 8) in 144 cases

Recommended Approaches to Resolve Contradictions:

  • Methodological Standardization:

    • Use consistent techniques for mutation detection

    • Standardize sample preparation and experimental conditions

    • Employ multiple complementary methods

  • Critical Examination of Potential Biases:

    • Consider selection of specimens

    • Evaluate potential PCR artifacts

    • Assess effects of cell culture passages on mutation status

  • Comprehensive Analysis:

    • Examine both coding and regulatory regions

    • Consider epigenetic mechanisms (methylation, histone modifications)

    • Investigate alternative splicing variants

  • Meta-analysis:

    • Pool data from multiple studies

    • Apply rigorous statistical methods

    • Account for heterogeneity in experimental approaches

What bioinformatic tools are most useful for analyzing Pongo abelii ST7 sequence and structural data?

Several computational approaches can enhance ST7 research:

Sequence Analysis Tools:

  • MUSCLE for multiple sequence alignment to compare ST7 across species

  • Jalview for visualization and analysis of sequence conservation

  • BLAST for identifying homologous sequences

Structural Analysis Tools:

  • Homology modeling using available templates (consider using human ST7 structure if available)

  • Molecular dynamics simulations to assess structural stability

  • Protein-protein interaction prediction tools

Functional Prediction Tools:

  • Gene Ontology enrichment analysis

  • Pathway analysis tools

  • Mutation effect prediction algorithms (SIFT, PolyPhen)

Data Integration Approaches:

  • Combine transcriptomic, proteomic, and genomic data

  • Integrate evolutionary conservation with structural information

  • Correlate sequence variations with functional outcomes

What CRISPR-Cas9 approaches could advance understanding of Pongo abelii ST7 function?

CRISPR-Cas9 technology offers powerful tools for ST7 functional studies:

Gene Editing Applications:

  • Knockout studies in cell lines to determine effects on proliferation and tumorigenicity

  • Knockin of specific mutations observed in human cancers

  • Domain-specific deletions to map functional regions

Methodological Considerations:

  • Design multiple guide RNAs targeting conserved regions

  • Include appropriate controls for off-target effects

  • Validate edits through sequencing

Advanced CRISPR Applications:

  • CRISPRi for transcriptional repression without genetic modification

  • CRISPRa for enhancing expression to study gain-of-function effects

  • Base editing for precise nucleotide modifications

Research Questions to Address:

  • Does ST7 knockout promote tumorigenesis in normal cells?

  • Can wildtype ST7 rescue the phenotype of ST7-deficient cancer cells?

  • Do specific domains have different functional consequences when deleted?

How might comprehensive multi-omics approaches enhance our understanding of ST7 function?

Integrative approaches can provide deeper insights:

Multi-omics Strategy:

  • Genomics: Assess genetic variations across primate species

  • Transcriptomics: Map expression patterns in various tissues and conditions

  • Proteomics: Identify interaction partners and post-translational modifications

  • Metabolomics: Evaluate downstream metabolic effects of ST7 activity

Integration Methods:

  • Network analysis to identify functional modules

  • Pathway enrichment to contextualize ST7 function

  • Machine learning approaches for pattern recognition

Potential Applications:

  • Identification of novel ST7-regulated pathways

  • Discovery of biomarkers associated with ST7 activity

  • Development of therapeutic approaches targeting ST7-dependent processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.