Recombinant Pongo abelii Surfeit locus protein 4 (SURF4)

Shipped with Ice Packs
In Stock

Description

Primary Structure

  • Amino Acid Sequence:
    The full-length protein comprises 269 amino acids (UniProt ID: Q5R705) with the sequence:
    MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW .

  • Domains:
    Contains multiple transmembrane regions and a triacidic motif (luminal domain) critical for electrostatic interactions with polybasic cargo motifs .

Physical Properties

ParameterSpecification
Molecular Weight~30 kDa (predicted)
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer + 6% Trehalose
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

ER-to-Golgi Cargo Transport

  • Mechanism: SURF4 binds polybasic motifs (e.g., (K/R)(K/R)(K/R)XX(K/R)(K/R) on secretory proteins like BMP8A and SFRP1 via its luminal triacidic motif, facilitating COPII vesicle packaging .

  • Key Clients:

    • Lipoproteins (e.g., ApoB)

    • Hedgehog signaling proteins (Shh, Dhh, Ihh)

    • Bone morphogenetic proteins (BMP8A) .

Disease Associations

  • Cancer:

    • Promotes oral squamous cell carcinoma (OSCC) proliferation and metastasis by enhancing aerobic glycolysis (AG). Silencing SURF4 reduces ATP/lactate production and stemness markers (OCT4, SOX2) .

    • Upregulated in ovarian cancer stem cells, correlating with chemoresistance .

  • Atherosclerosis: Hepatic SURF4 knockdown reduces plasma lipids and prevents atherosclerosis in mice .

Experimental Use Cases

  • Protein Trafficking Studies:
    Used in RUSH (Retention Using Selective Hook) assays to monitor ER export kinetics of polybasic motif-containing cargoes .

  • Therapeutic Target Screening:
    SURF4 inhibitors are explored for dyslipidemia and cancer therapy .

Key Findings

  1. Electrostatic Cargo Recognition:
    SURF4’s triacidic motif binds polybasic residues on cargoes like BMP8A, enabling ER exit. Mutations in this motif abolish trafficking .

  2. Subcellular Localization:
    SURF4 localizes to ER exit sites (ERES) and ERGIC, coordinating COPII vesicle formation .

  3. Knockdown Phenotypes:

    • Reduced ERGIC/Golgi integrity .

    • Impaired lipoprotein secretion and lipid homeostasis .

Future Directions

  • Mechanistic Studies: Elucidate SURF4’s role in N-terminal hydrophobic-proline-hydrophobic (φ-P-φ) motif recognition .

  • Clinical Translation: Develop SURF4-targeted therapies for hyperlipidemia and metastatic cancers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. Please indicate any format preferences in your order notes, and we will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Note: All our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution, storing it at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize the development of your preferred tag.
Synonyms
SURF4; Surfeit locus protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SURF4
Target Protein Sequence
MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWN CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW
Uniprot No.

Target Background

Function
SURF4, a protein residing in the endoplasmic reticulum, functions as a cargo receptor. Its role is to mediate the export of lipoproteins by recruiting cargos into COPII vesicles, facilitating their secretion. SURF4 specifically interacts with lipoproteins containing both APOB and APOA1, thereby regulating lipoprotein delivery and maintaining lipid homeostasis. It collaborates with the GTPase SAR1B to mediate the transport of circulating lipoproteins. SURF4 also promotes the secretion of PCSK9 and facilitates the efficient secretion of erythropoietin (EPO). Additionally, it may contribute to the maintenance of the endoplasmic reticulum-Golgi intermediate compartment architecture and the structure of the Golgi apparatus.
Database Links
Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How should recombinant Pongo abelii SURF4 be stored and handled for optimal stability?

For optimal stability and activity preservation, recombinant Pongo abelii SURF4 should be stored at -20°C in its supplied buffer (typically Tris-based buffer with 50% glycerol) . For extended storage periods, conservation at -80°C is recommended. When working with the protein, it's advisable to:

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Prepare working aliquots and store them at 4°C for up to one week

  • When thawing, allow the protein to reach room temperature gradually before use

  • Verify protein integrity before experiments using techniques such as SDS-PAGE

The protein is typically supplied in a storage buffer optimized for stability, containing Tris-based buffer with 50% glycerol . This high glycerol concentration helps prevent freeze-damage and maintains protein conformation during storage.

What is the ER-ESCAPE motif and how does it interact with SURF4?

The ER-Exit by Soluble Cargo using Amino-terminal Peptide-Encoding motif (ER-ESCAPE motif) refers to the specific amino-terminal tripeptides that are exposed after removal of leader sequences in secretory proteins . These motifs interact with SURF4 with varying affinities to regulate protein export from the ER.

The interaction occurs via a highly conserved lumenal domain of SURF4 that forms a binding pocket. This pocket is lined with hydrophobic and negatively charged residues, creating a geometry and charge landscape suitable for binding positively charged and hydrophobic ER-ESCAPE motifs . Recent structural and functional analyses have identified that:

  • The strength of the ER-ESCAPE motif determines the efficiency of cargo export

  • Proteins prone to aggregation (like dentin sialophosphoprotein and amelogenin) possess strong ER-ESCAPE motifs to facilitate rapid export and prevent aggregation

  • Specific changes in a single amino acid of the tripeptide can result in aggregate formation and failure to efficiently traffic cargo out of the ER

  • The presence of neighboring N-glycans may reduce binding due to steric effects

This interaction mechanism represents a sophisticated cellular strategy to maintain proteins at sub-aggregation concentrations during intracellular trafficking.

How does SURF4 mediate protein export from the ER, and which proteins are known to utilize this pathway?

SURF4 mediates protein export from the ER through a complex process involving recognition of specific cargo proteins and interaction with the COPII coat machinery. The export mechanism involves several steps:

  • SURF4 recognizes and binds cargo proteins via their ER-ESCAPE motifs in the ER lumen

  • This transmembrane receptor then connects the lumenal cargo to the cytosolic COPII coat

  • Different cargo proteins utilize distinct SEC24 cargo adaptor paralogs of the COPII coat

  • Some proteins engage with SURF4 co-translationally, contradicting previous models that suggested proteins gain export competency only after folding

Known proteins that utilize the SURF4-mediated export pathway include:

ProteinSEC24 Paralog RequiredCo-receptor NeededBinding Characteristics
PCSK9SEC24ATMED10Binding occurs after self-cleavage reveals ER-ESCAPE motif
Cab45SEC24C/DNone identifiedCo-translational binding to SURF4
NUCB1SEC24C/DNone identifiedCo-translational binding to SURF4
EPONot specifiedNone identifiedPhysical interaction confirmed

Bioinformatic analyses suggest that proteins with strong SURF4-binding motifs are predominantly proteases, receptor-binding ligands, and Ca2+-binding proteins . The diversity in interaction mechanisms highlights the complexity and specificity of the SURF4-mediated export system.

What are the most effective methods for studying SURF4-cargo interactions in vitro?

For studying SURF4-cargo interactions in vitro, researchers should consider multiple complementary approaches:

  • Protein-Protein Interaction Assays:

    • Pull-down assays using recombinant SURF4 as bait

    • Surface Plasmon Resonance (SPR) to determine binding kinetics and affinity

    • NanoBiT complementation assays, which have been successfully used to detect SURF4 interactions with SEC24 paralogs

    • Co-immunoprecipitation followed by mass spectrometry to identify novel interacting partners

  • Structural Studies:

    • Mutagenesis of the lumenal pocket of SURF4 to identify critical residues for binding

    • Crystallography or cryo-EM to resolve the structure of SURF4-cargo complexes

    • Computational docking of different ER-ESCAPE motifs to predict binding affinities

  • Co-translational Binding Studies:

    • Ribosome profiling coupled with crosslinking to capture co-translational interactions

    • In vitro translation systems combined with SURF4-coated surfaces to detect early binding events

When designing these experiments, researchers should consider using controls such as SURF4 mutants with disrupted binding pockets or cargo proteins with altered ER-ESCAPE motifs. These approaches can provide quantitative data on binding affinities, kinetics, and the structural basis of specificity between SURF4 and different cargo proteins.

How can CRISPR-Cas9 technology be utilized to study SURF4 function in cellular secretory pathways?

CRISPR-Cas9 technology offers powerful approaches for studying SURF4 function in cellular secretory pathways, as demonstrated by previous successful applications:

  • Generating SURF4 Knockout Cell Lines:

    • Design sgRNAs targeting SURF4, with multiple guides to ensure efficient targeting (previous studies achieved ~97% and 77% indel efficiency with different sgRNAs)

    • Create complete knockout cell lines to study global effects on protein secretion

    • Develop conditional knockout systems using inducible CRISPR to study temporal aspects of SURF4 function

  • Reporter Systems for High-Throughput Screening:

    • Engineer reporter cell lines expressing fluorescent-tagged cargo proteins (e.g., EPO-eGFP) that allow quantification of intracellular accumulation when SURF4 is disrupted

    • Implement dual-reporter systems (e.g., EPO-eGFP/A1AT-mCherry) to differentiate between specific SURF4-dependent cargo and general secretory pathway effects

    • Use FACS sorting of reporter cells for genome-wide CRISPR screens to identify additional components of the SURF4 pathway

  • Domain-Specific Mutagenesis:

    • Employ CRISPR base editing or prime editing to introduce specific mutations in functional domains of SURF4

    • Target the lumenal pocket, Phe-loop between transmembrane helices 4 and 5, or C-terminal tail to disrupt specific interactions with cargo or COPII components

A methodological workflow for CRISPR-based SURF4 research might include:

  • Design and validation of sgRNAs (aim for >70% editing efficiency)

  • Generation of knockout and domain-specific mutant cell lines

  • Phenotypic characterization using secretion assays and imaging techniques

  • Rescue experiments with wild-type or mutant SURF4 to confirm specificity

  • Quantitative analysis of cargo fate using pulse-chase experiments

This approach has proven effective, as demonstrated by studies showing that SURF4 targeting with multiple independent sgRNAs resulted in intracellular accumulation and extracellular depletion of EPO, with both phenotypes rescued by expression of SURF4 cDNA .

How does SURF4-mediated trafficking differ between evolutionary distant species, and what are the implications for using recombinant Pongo abelii SURF4 in human cell models?

  • Sequence Homology and Functional Domains:

    • Pongo abelii SURF4 and human SURF4 share high sequence identity (>95%), particularly in functional regions

    • The critical binding pocket for ER-ESCAPE motifs and interaction sites with COPII components show strong conservation

    • Transmembrane topology is preserved across species, suggesting structural conservation

  • Species-Specific Cargo Preferences:

    • While the core machinery is conserved, the specific cargo repertoire may differ between species

    • Some specialized secretory proteins evolved in primates may have developed optimized ER-ESCAPE motifs

    • The binding affinity for certain cargo proteins might differ slightly between human and orangutan SURF4

  • Experimental Considerations:

    • Recombinant Pongo abelii SURF4 can generally substitute for human SURF4 in functional studies

    • For precise affinity measurements or therapeutic applications, species-matching is recommended

    • When studying co-receptor interactions (like TMED10), potential species-specific differences should be considered

The high conservation of SURF4 across species suggests that fundamental mechanisms of ER export are evolutionarily ancient and essential for eukaryotic cell function. This conservation makes recombinant Pongo abelii SURF4 a valid model for many basic research applications in human cell systems.

What is the relationship between SURF4 function and disease states, particularly in protein trafficking disorders?

SURF4 dysfunction has been implicated in several disease states related to protein trafficking disorders, with emerging evidence suggesting therapeutic potential:

  • Secretory Protein-Related Disorders:

    • Mutations in ER-ESCAPE motifs of dentin proteins result in ER retention, potentially contributing to dentinogenesis imperfecta

    • SURF4 plays a critical role in EPO secretion, suggesting its involvement in disorders of erythropoiesis driven by aberrant EPO levels

    • Modulating SURF4 activity has been proposed as a potential treatment strategy for such disorders

  • Lipid Metabolism and Cardiovascular Disease:

    • SURF4 mediates very low-density lipoprotein secretion from hepatocytes

    • Silencing hepatic SURF4 reduces atherosclerosis development in mouse models without causing hepatic steatosis

    • This suggests SURF4 as a potential therapeutic target for cardiovascular diseases related to dyslipidemia

  • ER Stress-Related Conditions:

    • While SURF4 deletion does not directly induce ER stress , its role in preventing protein aggregation suggests involvement in conformational diseases

    • SURF4's preferential export of Ca2+-binding proteins may impact calcium homeostasis, with potential implications for disorders involving ER calcium dysregulation

  • Cancer and Secretory Phenotypes:

    • SURF4's role in protein secretion suggests potential involvement in cancer cell secretory phenotypes

    • Altered expression of SURF4 might contribute to changes in the tumor microenvironment through modified secretion profiles

Understanding the precise role of SURF4 in these disease contexts requires further research, particularly regarding:

  • SURF4 expression patterns in different disease states

  • The impact of SURF4 polymorphisms on disease susceptibility

  • The therapeutic potential of modulating SURF4 activity in a tissue-specific manner

What are the optimal conditions for expressing and purifying recombinant SURF4 for structural and functional studies?

Expressing and purifying recombinant SURF4 for structural and functional studies presents challenges due to its multiple transmembrane domains. Based on the literature and protein characteristics, the following methodological approach is recommended:

  • Expression System Selection:

    • Insect cell systems (Sf9 or High Five cells) generally yield better results for multi-pass transmembrane proteins compared to bacterial systems

    • HEK293 cells provide a mammalian environment that ensures proper folding and post-translational modifications

    • For high-throughput screening, yeast expression systems can be considered due to their ease of genetic manipulation

  • Construct Design Considerations:

    • Include affinity tags (His6, FLAG, or Strep-tag) for purification, preferably at the C-terminus to avoid interference with N-terminal cargo binding

    • Consider fusion partners that enhance solubility and expression (GFP can serve as both solubility enhancer and expression reporter)

    • For structural studies, remove flexible regions while preserving the lumenal pocket and transmembrane domains

    • Design constructs with TEV protease cleavage sites for tag removal after purification

  • Optimized Purification Protocol:

    • Solubilize membranes using mild detergents like DDM, LMNG, or GDN to preserve protein structure

    • Employ two-step purification: initial IMAC followed by size exclusion chromatography

    • For functional studies, consider reconstitution into nanodiscs or liposomes to maintain native conformation

    • For co-purification with cargo proteins, design constructs with stabilized interaction (e.g., disulfide trapping)

  • Quality Control Parameters:

    • Verify protein purity by SDS-PAGE (aim for >95% purity)

    • Confirm identity by mass spectrometry

    • Assess structural integrity using circular dichroism or thermal shift assays

    • Validate functionality through cargo binding assays before proceeding to detailed studies

For structural studies specifically, recent advances in cryo-EM for membrane proteins make this a preferred approach over crystallography for SURF4 structural determination.

How can researchers quantitatively assess the binding affinity between SURF4 and different ER-ESCAPE motifs?

Quantitatively assessing binding affinity between SURF4 and different ER-ESCAPE motifs requires specialized approaches due to the transmembrane nature of SURF4 and the short peptide characteristics of ER-ESCAPE motifs. Researchers can employ the following methodological strategies:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified SURF4 (preferably in nanodiscs) on a sensor chip

    • Flow peptides containing various ER-ESCAPE motifs at different concentrations

    • Determine association (kon) and dissociation (koff) rate constants

    • Calculate equilibrium dissociation constant (KD) as koff/kon

    • This method allows real-time monitoring of binding without labels

  • Microscale Thermophoresis (MST):

    • Label either SURF4 or peptides with a fluorescent dye

    • Measure changes in thermophoretic mobility upon binding

    • Determine KD values from concentration-dependent changes in thermophoresis

    • This method requires minimal sample amounts and works well with membrane proteins

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure heat changes upon binding

    • Calculate binding stoichiometry, enthalpy, and entropy in addition to KD

    • Provides complete thermodynamic profile of the interaction

    • Requires larger amounts of purified components

  • Cellular-Based Quantitative Assays:

    • Develop a fluorescence-based cargo trafficking assay using model cargo proteins with different ER-ESCAPE motifs

    • Quantify steady-state ER concentrations as a function of ER-ESCAPE motif strength

    • Create a systematic array of all possible tripeptide combinations to establish a comprehensive affinity profile

Previous research has established a logical subset of 8,000 possible tripeptides starting a model soluble cargo protein (growth hormone), demonstrating a continuum of steady-state ER concentrations ranging from low (high affinity for receptor) to high (low affinity) . This approach can be extended to develop a quantitative binding affinity scale for ER-ESCAPE motifs.

What are common challenges when working with recombinant SURF4 in experimental systems, and how can they be addressed?

Researchers working with recombinant SURF4 may encounter several challenges due to its transmembrane nature and functional properties. Here are common issues and recommended solutions:

  • Low Expression Levels:

    • Challenge: Multi-pass transmembrane proteins like SURF4 often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Use strong inducible promoters with tight regulation

      • Test different cell lines (HEK293S GnTI-, Expi293F for mammalian expression)

      • Include chemical chaperones in growth media (e.g., 4-phenylbutyrate)

  • Protein Aggregation:

    • Challenge: Membrane proteins are prone to aggregation during purification

    • Solutions:

      • Screen multiple detergents systematically (DDM, LMNG, GDN, etc.)

      • Maintain samples at 4°C throughout processing

      • Include glycerol (10-15%) in all buffers

      • Consider mild solubilization directly from cells rather than isolated membranes

  • Non-functional Recombinant Protein:

    • Challenge: Recombinant SURF4 may fold incorrectly or lack necessary post-translational modifications

    • Solutions:

      • Verify correct topology using protease protection assays

      • Assess glycosylation status by endoglycosidase treatment

      • Perform functional assays (cargo binding) to confirm activity

      • Use GFP fusion constructs to monitor proper folding and trafficking

  • Difficulties in Detecting Cargo Interactions:

    • Challenge: Transient or weak interactions can be difficult to capture and measure

    • Solutions:

      • Employ crosslinking approaches to stabilize interactions

      • Use proximity labeling methods (BioID, APEX) to identify interaction partners

      • Develop split-reporter systems for visualizing interactions in live cells

      • Consider co-expression of cargo and SURF4 to increase local concentrations

  • Variability in Cellular Assays:

    • Challenge: Cell-based trafficking assays may show high variability

    • Solutions:

      • Generate stable cell lines rather than using transient transfection

      • Implement CRISPR to create SURF4 knockout cell lines for clean rescue experiments

      • Use ratiometric reporters to normalize for expression level differences

      • Perform time-course experiments to capture kinetic differences

By anticipating these challenges and implementing appropriate solutions, researchers can improve the success rate of experiments involving recombinant SURF4.

How can researchers distinguish between SURF4-specific effects and general disruptions of the secretory pathway in experimental models?

Distinguishing SURF4-specific effects from general secretory pathway disruptions is critical for accurate interpretation of experimental results. Researchers should implement the following methodological approaches:

  • Use of Multiple Cargo Controls:

    • Implement dual-reporter systems with known SURF4-dependent and SURF4-independent cargoes

    • Previous research successfully used EPO-eGFP (SURF4-dependent) and A1AT-mCherry (SURF4-independent) to discriminate specific effects

    • Observe cargo with various ER-ESCAPE motif strengths to detect spectrum of SURF4 dependency

  • Rescue Experiments:

    • Perform complementation with wild-type SURF4 to verify phenotype reversibility

    • Use cross-species rescue (e.g., yeast Erv29p expression in SURF4-null human cells) to confirm evolutionary conservation of function

    • Implement domain-specific SURF4 mutants to pinpoint functional regions responsible for specific phenotypes

  • Comparative Analysis of Multiple Secretory Pathway Components:

    • In parallel, analyze markers of general ER stress (BiP, XBP1 splicing, ATF6 cleavage)

    • Monitor localization and function of other cargo receptors (ERGIC-53, p24 family)

    • Assess integrity of COPII components and general ER-to-Golgi trafficking

  • Quantitative Cargo Fate Analysis:

    • Perform pulse-chase experiments to distinguish between trafficking delays and complete blocks

    • Use subcellular fractionation to determine precise localization of retained cargo

    • Implement super-resolution microscopy to visualize co-localization with specific compartment markers

  • Statistical Analysis Approaches:

    • Apply appropriate statistical tests (e.g., Mann-Whitney U test for comparing two groups, Kruskal-Wallis test followed by Dunn test for multiple groups)

    • Present data as median with 95% confidence limits

    • Define significance threshold (typically p<0.05)

This systematic approach allows researchers to confidently attribute observed phenotypes to SURF4-specific functions rather than general secretory pathway disruptions, as demonstrated in previous studies that showed SURF4 deletion doesn't induce general ER stress despite affecting specific cargo trafficking .

What are emerging areas of research regarding SURF4's role in cellular homeostasis and disease?

Several promising research directions are emerging regarding SURF4's broader roles in cellular homeostasis and disease:

  • SURF4 in Lipid Metabolism and Cardiovascular Disease:

    • Recent findings indicate SURF4 mediates very low-density lipoprotein secretion from hepatocytes

    • Silencing hepatic SURF4 reduces atherosclerosis development without causing hepatic steatosis

    • Future research should explore tissue-specific SURF4 functions in lipid homeostasis and their implications for metabolic disorders

  • Co-translational Cargo Recognition Mechanisms:

    • The discovery that some proteins (Cab45, NUCB1) bind co-translationally to SURF4 challenges prevailing models of receptor engagement

    • This opens avenues for investigating how the translation machinery coordinates with the early secretory pathway

    • Potential research should explore the interplay between signal recognition particle, translocation channel, and SURF4 during nascent chain emergence

  • SURF4 in Specialized Secretory Cells:

    • Investigating SURF4's role in professional secretory cells (pancreatic β-cells, plasma cells, salivary gland cells)

    • Exploring whether SURF4 expression levels correlate with secretory capacity

    • Determining if SURF4 mutations contribute to secretory disorders in specialized tissues

  • Therapeutic Targeting of SURF4:

    • Developing small molecule modulators of SURF4-cargo interactions

    • Exploring tissue-specific SURF4 targeting for disorders like atherosclerosis

    • Investigating SURF4 overexpression as a strategy for enhancing therapeutic protein production, particularly for EPO and other biologics

  • SURF4 in Cellular Stress Responses:

    • Examining how SURF4-mediated export adapts to ER stress conditions

    • Investigating potential roles in unfolded protein response regulation

    • Studying SURF4's contribution to ER calcium homeostasis through preferential export of Ca2+-binding proteins

These emerging research areas highlight SURF4's significance beyond its established role as a cargo receptor and suggest potential therapeutic applications in various disease contexts.

How might advances in structural biology and computational methods enhance our understanding of SURF4-cargo selectivity?

Recent advances in structural biology and computational approaches offer exciting opportunities to deepen our understanding of SURF4-cargo selectivity:

  • Cryo-EM Advances for Membrane Protein Complexes:

    • High-resolution cryo-EM now enables visualization of transmembrane protein complexes in near-native environments

    • Future studies could resolve the structure of SURF4 alone and in complex with various cargo proteins

    • Capturing different states of the SURF4-cargo-COPII assembly would provide insights into the dynamic process of cargo selection and export

  • Integrative Structural Approaches:

    • Combining X-ray crystallography of soluble domains with cryo-EM of full-length protein

    • Implementing hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Using crosslinking mass spectrometry to identify contact points between SURF4 and cargo

  • Advanced Computational Modeling:

    • AI-based protein structure prediction (AlphaFold, RoseTTAFold) can generate high-confidence models of SURF4-cargo complexes

    • Molecular dynamics simulations can reveal the dynamics of cargo binding and release

    • Deep learning approaches can predict ER-ESCAPE motif affinities based on existing experimental data

  • Systems Biology Integration:

    • Multi-omics approaches to correlate SURF4 binding preferences with the cellular secretome

    • Network analysis to position SURF4 within the broader context of secretory pathway regulation

    • Quantitative models of how SURF4 affinity impacts proteostasis and prevents aggregation

  • High-Throughput Screening Platforms:

    • Development of comprehensive tripeptide libraries to systematically map all possible ER-ESCAPE motif interactions

    • Deep mutational scanning of SURF4 binding pocket to create a complete interaction profile

    • Cellular microarrays to assess trafficking efficiency of thousands of cargo variants simultaneously

These advances will likely transform our understanding of the molecular basis for SURF4-cargo selectivity, potentially enabling precise engineering of secretory proteins with optimized trafficking properties for biotechnological applications and providing insights for therapeutic targeting of specific SURF4-cargo interactions in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.