Recombinant Pongo abelii Tetraspanin-1 (TSPAN1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN1; Tetraspanin-1; Tspan-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TSPAN1
Target Protein Sequence
MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFL IAAGVVVFALGFLGCYGAKTESKCALMTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTL LVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYLKENHAFPPFCCNDNIT NTANDTCTKQKAEDQKVEGCFNQLLYDIRTNAVTVGGVAAGIGGLELAAMIVSMYLYCNL Q
Uniprot No.

Target Background

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.

Q&A

How do researchers effectively handle and store recombinant Pongo abelii TSPAN1?

Optimal handling and storage of recombinant TSPAN1 from Pongo abelii requires specific conditions to maintain protein integrity and functionality:

Storage Conditions:

  • For regular use: Store at -20°C

  • For extended storage: Conserve at -20°C or -80°C

  • Working aliquots: Maintain at 4°C for up to one week

Buffer Composition:

  • Typically supplied in Tris-based buffer with 50% glycerol, optimized for protein stability

Handling Precautions:

  • Avoid repeated freeze-thaw cycles as this significantly compromises protein integrity

  • Allow protein to thaw completely on ice before use

  • Centrifuge briefly before opening to ensure all material is at the bottom of the tube

Following these guidelines ensures maximum stability and activity retention for experimental applications.

What are the recommended cloning strategies for TSPAN1 from Pongo abelii?

Based on published methodologies, the following cloning approach has been successful for TSPAN1:

Primer Design:
Forward primer: 5′-AAGCTAGCATGCAGTGCTTCAGCTTC-3′
Reverse primer: 5′-TTGGATCCTTATTGTAGATTGCAGTA-3′

Restriction Sites:
The amplified cDNA can be effectively cloned into NheI/BamHI restriction sites of expression vectors such as the pCDH-Promoter-MCS-EF1 Lentivector system .

Vector Modifications:
When using vectors with GFP sequences, GFP deletion may be conducted using PCR amplification with primers:

  • Forward: 5′-CCTACGCTAGACGCCACCATGACCGAGTACAAGCCC-3′

  • Reverse: 5′-GGGCTTGTACTCGGTCATGGTGGCGTCTAGCGTAGG-3′

This methodology enables efficient generation of expression constructs for functional studies of TSPAN1 in various experimental systems.

What role does TSPAN1 play in disease progression and cancer development?

Research has revealed TSPAN1's significant role in cancer progression, particularly in the transformation from endometriosis to ovarian clear cell carcinoma (OCCC):

Expression Changes During Disease Progression:

  • TSPAN1 mRNA levels increase significantly by 2.4- to 3.4-fold in atypical endometriosis compared to normal endometriosis

  • A dramatic 80.7- to 101-fold increase is observed in OCCC relative to endometriosis

Mechanistic Insights:
TSPAN1 promotes endometriotic cell growth and invasion through activation of AMP-activated protein kinase (AMPK) signaling pathways . This mechanism represents a critical link between TSPAN1 overexpression and cancer progression.

Clinical Significance:
Upregulated TSPAN1 levels are considered an early event in the development of high-risk endometriosis with potential for malignant transformation, suggesting its value as a biomarker for identifying patients requiring closer monitoring .

These findings highlight TSPAN1 as both a potential diagnostic marker and therapeutic target in the context of endometriosis-associated ovarian cancers.

How do tetraspanins, including TSPAN1, function in viral infections and host-pathogen interactions?

Tetraspanins have emerged as important host factors in viral infections, particularly in HIV-1 infection mechanisms:

Roles in Viral Entry and Replication:
While specific TSPAN1 interactions with viruses are not detailed in current research, other tetraspanins demonstrate significant functions:

  • Membrane Organization: Tetraspanins regulate specialized microdomains that can serve as platforms for viral entry and assembly .

  • Cytoskeletal Regulation: TSPAN7 positively regulates actin nucleation and polymerization, affecting HIV-1 virion retention at actin-rich dendrites in dendritic cells .

  • Intracellular Trafficking: Tetraspanins modulate intracellular signaling and trafficking events critical for viral replication cycles .

  • Viral Replication Support: CD63 depletion correlates with reduced HIV-1 virus titers in multiple cell types, affecting reverse transcription, integration of viral DNA, and viral protein production .

  • Host Factor Regulation: CD81 directly binds host deoxynucleotide triphosphate phosphohydrolase SAMHD1, promoting its degradation and ensuring sufficient dNTP substrate for HIV-1 reverse transcription .

These findings suggest potential parallel roles for TSPAN1 that warrant investigation in the context of viral infection and replication.

How can researchers quantify and characterize TSPAN1 expression in experimental models?

For consistent quantification and characterization of TSPAN1 in research settings, several methodological approaches can be employed:

Immunohistochemistry (IHC) Scoring System:
A standardized scoring system based on:

  • Intensity: 0 = negative, 1 = weak, 2 = moderate, 3 = strong

  • Percentage of positive cells: 0 = 0%, 1 = 1–25%, 2 = 26–50%, 3 = 51–100%

This approach allows for consistent assessment across different tissue samples and studies.

mRNA Expression Analysis:

  • Quantitative RT-PCR using specific primers for TSPAN1

  • RNA sequencing for comprehensive transcriptome profiling

  • Digital droplet PCR for absolute quantification in samples with low expression

Protein Detection Methods:

  • Western blotting with specific antibodies

  • Flow cytometry for cell surface expression analysis

  • ELISA for quantitative measurement in cell lysates or tissue homogenates

Functional Characterization:

  • Overexpression and knockdown studies to assess phenotypic changes

  • Co-immunoprecipitation to identify protein-protein interactions

  • Subcellular localization studies using fluorescently tagged TSPAN1

These methodologies provide complementary approaches to thoroughly characterize TSPAN1 expression and function in experimental models.

How does Pongo abelii TSPAN1 compare structurally and functionally with human TSPAN1?

Comparative analysis of TSPAN1 between Pongo abelii and humans offers valuable insights into the evolutionary conservation and potential functional similarities:

Sequence Comparison:
While detailed alignment data is not provided in the search results, the high degree of conservation typically observed among tetraspanins and the close evolutionary relationship between humans and orangutans suggest significant homology.

Functional Conservation:
The apparent role of TSPAN1 in cancer progression in humans parallels observations in other mammals, suggesting functional conservation across species . This conservation extends to:

  • Membrane organization: Formation of tetraspanin-enriched microdomains

  • Signaling pathways: Interaction with AMPK and potentially other signaling cascades

  • Cell adhesion and migration: Functions critical to normal development and disease processes

Research Applications:
The similarities between Pongo abelii and human TSPAN1 suggest that findings from orangutan models may have translational relevance to human disease, particularly in cancer research and viral infection studies.

What insights can orangutan TSPAN1 provide about primate cognition and tool use?

While TSPAN1 has not been directly studied in relation to orangutan cognition, research on Pongo abelii has revealed remarkable cognitive abilities:

Problem-Solving Abilities:
Sumatran orangutans (Pongo abelii) demonstrate sophisticated problem-solving skills, including the use of water as a tool. In experimental settings, orangutans collected water from a drinker and added it to a tube containing an out-of-reach peanut to raise the water level and retrieve the food .

Learning and Adaptation:

  • All tested orangutans solved this problem in their first trial

  • The time required to solve the problem decreased exponentially across sessions, from an average of 540 seconds in the first trial to just 31 seconds in the last trial

  • Subjects required approximately five mouthfuls of water in the first trial, reducing to three mouthfuls in subsequent trials

Cognitive Implications:
This behavior represents a likely candidate for insightful problem solving, demonstrating orangutans' capacity for understanding physical properties (water displacement) and causal relationships .

While not directly related to TSPAN1 biology, these cognitive capabilities underscore the importance of studying Pongo abelii as a model system for understanding primate evolution and cognition.

How should experimental controls be designed for TSPAN1 functional studies?

Designing appropriate controls is critical for robust TSPAN1 research:

Negative Controls:

  • Empty vector transfection parallel to TSPAN1 expression constructs

  • Non-targeting siRNA/shRNA for knockdown experiments

  • Isotype-matched antibodies for immunoprecipitation and immunostaining

Positive Controls:

  • Known TSPAN1-expressing cell lines or tissues

  • Recombinant protein standards for quantification assays

  • Validated TSPAN1 antibodies with confirmed specificity

Experimental Validation Controls:

  • For overexpression studies:

    • Verify expression levels by Western blot and qPCR

    • Include dose-response experiments with varying expression levels

  • For knockdown studies:

    • Confirm reduction at both protein and mRNA levels

    • Include rescue experiments with resistant constructs

  • For functional assays:

    • Include pathway inhibitors to confirm specificity (e.g., AMPK inhibitors when studying TSPAN1-AMPK interactions)

    • Perform parallel experiments with related tetraspanins to assess family-specific effects

What are the challenges in producing and purifying functional recombinant TSPAN1?

Producing functional recombinant membrane proteins like TSPAN1 presents several challenges:

Expression System Challenges:

  • Mammalian systems provide proper folding and post-translational modifications but often yield lower protein amounts

  • Bacterial systems offer higher yields but may not properly fold membrane proteins

  • Insect cell systems balance yield and proper processing but require specialized expertise

Solubilization and Purification Challenges:

  • Membrane proteins require careful detergent selection to maintain native conformation

  • Harsh solubilization conditions may denature the protein

  • Purification must be performed in the presence of stabilizing detergents

Quality Control Considerations:

  • Confirming proper folding of purified protein

  • Assessing functionality through binding assays or structural studies

  • Verifying homogeneity and absence of aggregates

Storage Stability:
As indicated in the product information, TSPAN1 requires specific storage conditions (-20°C or -80°C for extended storage) and buffer composition (Tris-based buffer with 50% glycerol) . Working aliquots should be maintained at 4°C for no more than one week to preserve activity.

Addressing these challenges requires optimization at each step of the production and purification process.

How might TSPAN1 be developed as a biomarker for early cancer detection?

The significant upregulation of TSPAN1 during malignant transformation suggests promising applications as a cancer biomarker:

Development Pathway:

  • Validation Studies:

    • Larger cohort studies to confirm expression patterns in various stages of disease

    • Determination of sensitivity and specificity for detecting high-risk endometriosis

  • Detection Methodologies:

    • Development of specific antibodies for immunohistochemistry

    • Design of sensitive ELISA or other immunoassays for detection in patient samples

    • Integration into multiplex biomarker panels for improved accuracy

  • Clinical Implementation:

    • Establishment of standardized scoring systems and cutoff values

    • Development of minimally invasive sampling techniques

    • Creation of point-of-care testing platforms

The dramatic increase (up to 101-fold) in TSPAN1 expression during progression to OCCC provides a substantial dynamic range for detection, potentially enabling earlier intervention in high-risk patients .

What potential exists for targeting TSPAN1 in therapeutic development?

Based on its role in disease progression, TSPAN1 represents a promising therapeutic target:

Therapeutic Strategies:

  • Direct TSPAN1 Targeting:

    • Monoclonal antibodies against accessible extracellular domains

    • Small molecule inhibitors disrupting protein-protein interactions

    • RNA interference approaches (siRNA, antisense oligonucleotides)

  • Pathway-Based Interventions:

    • Modulation of AMPK signaling to counteract TSPAN1-mediated effects

    • Targeting downstream effectors in TSPAN1 signaling cascades

  • Combination Approaches:

    • TSPAN1 inhibition combined with conventional chemotherapy

    • Dual targeting of multiple tetraspanins for enhanced efficacy

Challenges to Address:

  • Specificity to minimize off-target effects

  • Delivery mechanisms for targeting specific tissues

  • Resistance mechanisms that may develop

The established connection between TSPAN1 and AMPK activation in promoting endometriotic cell growth provides a clear mechanistic rationale for therapeutic intervention .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.