Recombinant Pongo abelii Tetraspanin-6 (TSPAN6)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

Commercial suppliers provide standardized formulations:

SupplierCatalog NumberExpression SystemPurityTag
cbm15CSB-CF732723PYXE. coli>90%Variable
Creative BiomartRFL29414PFE. coli>90%His tag
GeneBioSystemsN/AE. coli>90%Variable

Reconstitution protocols recommend dissolving lyophilized protein in deionized water (0.1–1.0 mg/mL) with glycerol for stability .

Immune Regulation

TSPAN6 negatively regulates retinoic acid-inducible gene I (RIG-I)-like receptor (RLR) signaling by:

  • Undergoing Lys-63-linked ubiquitination upon RLR activation .

  • Binding mitochondrial antiviral signaling protein (MAVS), disrupting TRAF3/MITA/IRF3 recruitment to MAVS .

  • Suppressing IFN-β and NF-κB promoter activation in response to viral RNA .

Alzheimer’s Disease Pathology

  • Amyloid Precursor Protein (APP) Metabolism: TSPAN6 increases APP C-terminal fragments (APP-CTF) and Aβ levels by impairing autophagosome-lysosomal fusion .

  • Exosome Secretion: Recruits syntenin to promote APP-CTF secretion via exosomes, linking TSPAN6 to amyloid plaque formation .

Cancer Research

  • Colorectal Cancer: Acts as a regulator of carcinogenesis, though mechanisms remain under investigation .

Key Research Findings

Study FocusKey InsightCitation
RLR Signaling InhibitionTSPAN6 ubiquitination disrupts MAVS signalosome assembly, reducing antiviral responses.
APP-CTF TraffickingTSPAN6 diverts APP-CTF from lysosomal degradation to exosomal secretion.
Structural DeterminantsFirst transmembrane domain essential for MAVS interaction and immune suppression.

Antibody and Detection Tools

The Proteintech TSPAN6 antibody (12293-1-AP) validates recombinant protein applications:

  • Applications: Western blot (1:500–1:2,000 dilution), ELISA .

  • Cross-Reactivity: Confirmed in human, mouse, and rat samples .

Research Implications

Recombinant Pongo abelii TSPAN6 enables mechanistic studies of tetraspanins in viral immunity, neurodegenerative diseases, and oncology. Its role in APP-CTF turnover highlights therapeutic potential for Alzheimer’s, while immune regulatory functions suggest targets for antiviral therapies . Standardized production protocols ensure reproducibility across studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TSPAN6; Tetraspanin-6; Tspan-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TSPAN6
Target Protein Sequence
MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV
Uniprot No.

Target Background

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Pongo abelii Tetraspanin-6 (TSPAN6)?

Recombinant Pongo abelii Tetraspanin-6 (TSPAN6) is a full-length (245 amino acid) protein from the tetraspanin family, produced through recombinant technology using expression systems such as E. coli. The protein is derived from Pongo abelii (Sumatran orangutan) and has significant homology with human TSPAN6. TSPAN6 functions as a membrane scaffold protein that participates in various cellular processes including protein trafficking and regulation of exosome production. The recombinant form typically contains tags (such as His-tag) to facilitate purification and detection in experimental settings .

How are recombinant TSPAN6 proteins typically reconstituted for laboratory use?

Recombinant TSPAN6 is typically supplied as a lyophilized powder that requires proper reconstitution for experimental use. The recommended protocol involves:

  • Brief centrifugation of the vial prior to opening to bring contents to the bottom

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol (5-50% final concentration) to prevent protein denaturation

  • Aliquoting for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

After reconstitution, working aliquots can be stored at 4°C for up to one week to maintain protein stability. This methodology preserves the structural integrity and functional properties of the protein for experimental applications .

What is the role of TSPAN6 in exosome production and secretion?

TSPAN6 functions as a negative regulator of exosome production through its interaction with syntenin and syndecan-4. Experimental evidence demonstrates that TSPAN6 depletion (via siRNA) increases the total number of secreted particles as measured by nanoparticle tracking analysis, without affecting particle size. Conversely, TSPAN6 overexpression decreases exosome secretion .

Mechanistically, TSPAN6 modulates exosome secretion through:

  • Direct interaction with syntenin PDZ domains via its C-terminal PDZ-binding motif

  • Regulation of syndecan-4 C-terminal fragment (SDC4-CTF) trafficking

  • Direction of SDC4-CTF toward lysosomal degradation rather than exosomal secretion

This regulatory function positions TSPAN6 as a critical control point in the balance between exosomal secretion and lysosomal degradation pathways .

How does TSPAN6 interact with syntenin-1 and what is the functional significance?

TSPAN6 directly interacts with the PDZ domains of syntenin-1 through its canonical PDZ-binding motif located at the C-terminus. Surface plasmon resonance (SPR) experiments have confirmed this direct interaction and demonstrated that deletion of the last three C-terminal residues of TSPAN6 abolishes binding to syntenin-1 .

The functional significance of this interaction includes:

  • Regulation of cargo sorting between exosomal secretion and lysosomal degradation

  • Formation of a tripartite complex with transmembrane TGF-α and syntenin-1

  • Modulation of EGFR signaling pathways through controlled release of growth factors

This interaction represents a crucial mechanism by which TSPAN6 exerts its regulatory effects on exosome biogenesis and growth factor signaling .

What is the mechanism by which TSPAN6 directs proteins to lysosomal degradation?

TSPAN6 plays a significant role in directing syndecan-4 C-terminal fragments (SDC4-CTF) and associated cargo to lysosomal degradation. The mechanism involves:

  • TSPAN6 depletion increases cellular levels of SDC4-CTF by approximately 2-fold

  • Chloroquine treatment (a lysosomal inhibitor) enhances SDC4-CTF levels, confirming lysosomal degradation as the primary pathway

  • After chloroquine treatment, SDC4-CTF levels become similar in TSPAN6-transfected and control cells, indicating TSPAN6's role in lysosomal targeting

  • TSPAN6 also supports the degradation of specific signaling receptors like EGFR that are partially associated with SDC4

This mechanism demonstrates that TSPAN6 functions to divert SDC4-CTF and associated cargo from exosomal secretory routes toward lysosomal degradation, thereby regulating the availability of these components for intercellular communication .

How does TSPAN6 function as a tumor suppressor in colorectal cancer?

TSPAN6 functions as a tumor suppressor in colorectal cancer (CRC) through several interconnected mechanisms:

  • Attenuation of the EGFR-based signaling axis by forming a tripartite complex with transmembrane TGF-α and syntenin-1

  • Negative regulation of TGF-α secretion, limiting the availability of this growth factor for EGFR activation

  • Suppression of extracellular vesicle-associated TGF-α release

Experimental evidence supporting TSPAN6's tumor suppressor role includes:

  • Deletion of TSPAN6 in APCmin/+ mice (a model for premalignant CRC) increased adenoma formation and tumor size

  • TSPAN6 expression is frequently decreased or lost in human CRC samples

  • High TSPAN6 expression correlates with better survival in CRC patients

These findings collectively establish TSPAN6 as a negative regulator of oncogenic signaling pathways in colorectal epithelium .

What is the relationship between TSPAN6 expression and response to EGFR-targeted therapies?

TSPAN6 expression in colorectal cancer has been identified as a potential predictive biomarker for response to EGFR-targeted therapies:

These findings suggest that TSPAN6 expression could serve as a clinically relevant biomarker for patient stratification in EGFR-targeted therapeutic approaches for colorectal cancer .

How does TSPAN6 regulate TGF-α secretion and EGFR signaling?

TSPAN6 negatively regulates TGF-α secretion and subsequent EGFR signaling through a molecular pathway involving:

  • Formation of a tripartite complex with the transmembrane form of TGF-α (tmTGF-α) and the adaptor protein syntenin-1

  • Control of tmTGF-α trafficking and processing

  • Regulation of extracellular vesicle production containing tmTGF-α

The deletion of TSPAN6 results in:

  • Increased production of tmTGF-α associated with extracellular vesicles

  • Enhanced activation of EGF-dependent signaling pathways

  • Promotion of neoplastic transformation in intestinal and colonic epithelia

This regulatory mechanism positions TSPAN6 as a critical modulator of growth factor signaling that influences cellular proliferation and transformation in colorectal tissue .

What are the optimal storage and handling conditions for recombinant TSPAN6?

For optimal maintenance of recombinant TSPAN6 stability and activity, the following storage and handling conditions are recommended:

ConditionRecommendation
Long-term storage-20°C/-80°C in aliquots to prevent repeated freeze-thaw cycles
Storage bufferTris-based buffer with 50% glycerol, pH 8.0
Short-term storageWorking aliquots at 4°C for up to one week
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Freeze-thawRepeated freezing and thawing is not recommended

These conditions ensure that the protein maintains its structural integrity and functional properties for experimental applications. The addition of glycerol serves as a cryoprotectant to prevent protein denaturation during freezing and thawing cycles .

What experimental approaches are used to study TSPAN6's role in exosome biology?

Several complementary experimental approaches have been employed to elucidate TSPAN6's role in exosome biology:

  • Nanoparticle Tracking Analysis (NTA): Used to quantify the number and size of secreted exosomes under conditions of TSPAN6 depletion or overexpression

  • Loss-of-function and gain-of-function studies:

    • siRNA-mediated knockdown to demonstrate increased exosome secretion

    • Transient overexpression of HA-tagged TSPAN6 to demonstrate decreased exosome secretion

  • Biochemical analysis of exosomal cargo:

    • Western blotting to analyze syntenin, syndecan-4 CTF, CD63, CD9, and CD81 levels in exosomes

    • Comparison of "binders" (cargo binding directly to syntenin PDZ domains) vs. "non-binders"

  • Protein-protein interaction studies:

    • Surface plasmon resonance (SPR) to demonstrate direct interaction between TSPAN6 and syntenin PDZ domains

    • Mutation studies (deletion of C-terminal residues) to verify the importance of the PDZ-binding motif

These methodologies provide complementary approaches to understanding the mechanistic role of TSPAN6 in regulating exosome production and composition .

How can animal models be used to investigate TSPAN6's tumor suppressor function?

Animal models, particularly those relevant to colorectal cancer, have been instrumental in establishing TSPAN6's tumor suppressor function:

  • APCmin/+ mouse model:

    • Deletion of TSPAN6 in APCmin/+ mice increases adenoma formation and tumor size

    • This model serves as a well-established system for studying premalignant CRC

    • Allows for assessment of TSPAN6's impact on the early stages of intestinal neoplasia

  • Molecular pathway analysis in animal models:

    • Investigation of EGFR-dependent signaling in TSPAN6-deleted mice

    • Analysis of TGF-α secretion and extracellular vesicle production

    • Examination of TSPAN6's interaction with syntenin-1 in vivo

  • Translational relevance:

    • Correlation of findings from animal models with human CRC samples

    • Validation of molecular mechanisms identified in vitro using animal tissue samples

    • Assessment of potential therapeutic implications in preclinical models

These animal model approaches provide crucial in vivo evidence of TSPAN6's biological functions and its potential as a therapeutic target or biomarker in colorectal cancer .

How does TSPAN6 expression correlate with patient survival in colorectal cancer?

Analysis of 463 colorectal tumor samples from the Cancer Genome Atlas dataset has revealed significant correlations between TSPAN6 expression and patient outcomes:

  • Patients with high TSPAN6-expressing adenocarcinomas show significantly better survival compared to those with low TSPAN6-expressing tumors

  • The survival advantage associated with TSPAN6 expression is particularly pronounced in:

    • Advanced tumors (T4, N2, or M1 stages)

    • Tumors with extensive lymphovascular invasion

  • The correlation between TSPAN6 expression and survival remains significant even after adjusting for other tumor-specific factors, suggesting an independent prognostic value

This epidemiological evidence supports the biological findings regarding TSPAN6's tumor suppressor function and suggests its potential utility as a prognostic biomarker in clinical settings .

What is the potential of TSPAN6 as a predictive biomarker for EGFR-targeted therapies?

TSPAN6 shows promising potential as a predictive biomarker for EGFR-targeted therapies in colorectal cancer:

  • Analysis of samples from the COIN clinical trial demonstrated that TSPAN6-positive patients responded better to Cetuximab-based therapies

  • The predictive value of TSPAN6 expression was independent of tumor molecular profile, including:

    • KRAS mutation status, which is currently the primary biomarker used for patient selection

    • Other common CRC genetic alterations

  • The mechanistic basis for this predictive value likely involves TSPAN6's role in:

    • Regulation of the EGFR signaling axis

    • Control of TGF-α secretion, a key EGFR ligand

    • Modulation of downstream signaling pathways

These findings suggest that TSPAN6 expression analysis could potentially improve patient stratification for EGFR-targeted therapies, beyond current molecular markers .

What are the challenges in developing TSPAN6-based therapeutic approaches?

Several challenges exist in translating TSPAN6 research into therapeutic applications:

  • Protein delivery challenges:

    • As a transmembrane protein, TSPAN6 cannot be directly administered as a therapeutic agent

    • Restoration of TSPAN6 expression in tumors would require gene therapy approaches

  • Specificity of molecular interactions:

    • The complex interaction network of TSPAN6 with syntenin-1, syndecans, and growth factors

    • Potential off-target effects of disrupting these interactions

  • Cancer heterogeneity:

    • Variable expression of TSPAN6 across different tumor types and individual patients

    • Differential responses based on molecular subtypes of colorectal cancer

  • Biomarker validation:

    • Need for large-scale clinical validation of TSPAN6 as a predictive biomarker

    • Standardization of detection methods for clinical application

Addressing these challenges will require multidisciplinary approaches combining molecular biology, drug delivery technologies, and clinical validation studies .

What are promising areas for further research on TSPAN6 function?

Several promising areas for future TSPAN6 research include:

  • Expanded cancer types:

    • Investigation of TSPAN6's role in cancers beyond colorectal cancer

    • Comparison of its functions across different tissue contexts

  • Detailed mechanistic studies:

    • Further elucidation of the tripartite complex (TSPAN6-syntenin-1-TGF-α)

    • Investigation of additional TSPAN6-interacting partners

    • Structural studies of the interaction domains

  • Therapeutic targeting:

    • Development of small molecules that mimic TSPAN6's tumor suppressor function

    • Exploration of approaches to restore TSPAN6 expression in tumors

  • Exosome biology:

    • Further characterization of TSPAN6's role in exosome composition and function

    • Investigation of TSPAN6-regulated exosomes in intercellular communication

  • Clinical applications:

    • Development of standardized assays for TSPAN6 detection in clinical samples

    • Large-scale clinical trials to validate TSPAN6 as a biomarker

These research directions could significantly advance our understanding of TSPAN6 biology and its potential applications in cancer diagnosis and treatment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.