Recombinant Pongo abelii TM2 domain-containing protein 2 (TM2D2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo Abelii TM2 Domain-Containing Protein 2 (TM2D2)

Recombinant Pongo abelii TM2 domain-containing protein 2 (TM2D2) is a protein that, in this recombinant form, is expressed in E. coli and fused to an N-terminal His tag . The TM2D family proteins, including TM2D2, are conserved in metazoans and are encoded by three separate genes in each model organism species that has been sequenced .

General Information

CategoryDescription
SpeciesPongo abelii (Sumatran orangutan)
SourceE. coli
TagHis tag (N-terminal)
Protein LengthFull Length of Mature Protein (36-214 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
SynonymsTM2D2; TM2 domain-containing protein 2
UniProt IDQ5RCC0
Other SpeciesMouse, Rat, Rhesus Macaque, Human

Biological Significance and Functions

TM2D proteins are implicated in the regulation of Notch signaling and neuronal function . Studies have explored the role of TM2D genes in the context of Alzheimer's disease, and their potential involvement in regulating γ-secretase activity, a key enzyme in the production of amyloid-beta peptides .

Availability

Recombinant Pongo abelii TM2D2 protein is available for purchase from some suppliers . It is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . Aliquoting is recommended for multiple uses, and repeated freezing and thawing should be avoided .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
TM2D2; TM2 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-214
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TM2D2
Target Protein Sequence
QNATAEPELTSAGAAQPEGPGAAASWEYSDPHSPVILCSYLPDEFIECEDPVDHVGNATA SQELGYGCLKFGGQAYSDVEHTSVQCHALAGIECASPRTFLRENKPCIKYTGHYFITTLL YSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTVY
Uniprot No.

Target Background

Database Links
Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How evolutionarily conserved is the TM2D gene family across species?

The TM2D gene family demonstrates remarkable evolutionary conservation:

  • TM2D proteins are conserved across metazoans

  • Most model organisms contain three separate TM2D genes

  • The transmembrane domains and intracellular loop regions show high conservation throughout evolution

  • BLAST analysis reveals significant homology between TM2D2 proteins from different species:

    • Pongo abelii TM2D2 shares significant sequence similarity with TM2D proteins from humans, mice, Xenopus, and other vertebrates

    • The C. elegans ortholog (C41D11.9) also shows considerable similarity

The high conservation of key domains suggests fundamental biological functions that have been maintained through evolutionary history. Particularly conserved is the DRF motif, which is found in some G-protein coupled receptors where it mediates conformational changes upon ligand binding .

What experimental approaches are most effective for studying TM2D2 function in neuronal development?

For investigating TM2D2's role in neuronal development, several complementary approaches are recommended:

Genetic Approaches:

  • CRISPR/Cas9-mediated knockout models: Following the approach used in Drosophila, where homology directed repair (HDR) with a visible marker was used to generate TM2D2 null alleles

  • Conditional knockout systems to study tissue-specific effects

  • Rescue experiments with wild-type vs. mutant forms to validate specificity

Cellular Assays:

  • Notch signaling reporter assays to quantify pathway activity

  • Electrophysiological measurements to assess neuronal function, as neurological defects were observed in Drosophila TM2D mutants

  • Cell fate determination assays, particularly for studying neurogenic phenotypes

Molecular Approaches:

  • Protein interaction studies (co-immunoprecipitation, proximity labeling)

  • Subcellular localization experiments to determine where TM2D2 functions

  • Structure-function studies focusing on the conserved DRF motif

The maternal-effect neurogenic phenotype observed in Drosophila provides a valuable readout for functional studies, with lateral inhibition disruption during ectodermal cell-fate decisions serving as a quantifiable endpoint .

What is the relationship between TM2D2 and other TM2D family members in the context of neurological function?

The three TM2D family members (TM2D1, TM2D2, and TM2D3) demonstrate significant functional relationships:

Functional Overlap:

  • In Drosophila, knockout of any single TM2D gene produces the same maternal-effect neurogenic phenotype

  • Triple knockout animals are not phenotypically worse than single knockouts, suggesting these genes function together in the same pathway

Structural Similarities:

  • All three proteins contain the characteristic dual transmembrane domains and conserved DRF motif

  • They differ primarily in their extracellular regions

Pathological Relevance:

  • TM2D3 has been implicated in late-onset Alzheimer's disease (LOAD) through exome-wide association studies

  • A rare variant (p.P155L) in TM2D3 is associated with increased LOAD risk and earlier age-of-onset

  • Another variant (p.P69L) has been reported in early-onset Alzheimer's disease (EOAD) or frontotemporal dementia

This suggests that while the TM2D family members may have similar developmental functions, TM2D3 (and potentially other members) may have additional roles in neurodegenerative diseases. Understanding TM2D2's relationship to TM2D3 could reveal insights into neurodegeneration mechanisms .

How can researchers effectively express and purify recombinant Pongo abelii TM2D2 for functional studies?

For optimal expression and purification of recombinant Pongo abelii TM2D2:

Expression Systems Options:

  • Yeast expression systems have proven successful for recombinant Pongo abelii proteins

  • Alternatives include E. coli, baculovirus, and mammalian cell systems, each with different advantages for membrane protein expression

Key Expression Parameters:

  • Expression region: 36-214 amino acids for full-length protein

  • Storage buffer: Tris-based buffer with 50% glycerol

  • Storage conditions: -20°C for short-term; -80°C for extended storage

  • Working conditions: Store aliquots at 4°C for up to one week

Purification Considerations:

  • Transmembrane proteins require detergent-based extraction methods

  • Tag options should be determined during the production process

  • Affinity chromatography followed by size exclusion chromatography is recommended for highest purity

  • Avoid repeated freeze-thaw cycles to maintain protein integrity

For functional assays, researchers should validate proper folding and membrane insertion of the recombinant protein, particularly for the transmembrane domains that are critical for function.

What is known about TM2D2's role in Notch signaling and how can this be experimentally investigated?

TM2D2 is implicated in Notch signaling based on several key observations:

Evidence for Notch Pathway Involvement:

  • Drosophila TM2D2 (amaretto) mutants exhibit neurogenic phenotypes characteristic of Notch signaling defects

  • Overexpression of the conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling at the γ-secretase cleavage step

  • The phenotypes can be observed during cell fate decisions in developing ectoderm, where Notch mediates lateral inhibition

Experimental Approaches:

  • Notch Reporter Assays:

    • Transfect cells with Notch reporters (e.g., CSL-luciferase) with/without TM2D2

    • Measure changes in Notch-dependent transcription

  • γ-Secretase Cleavage Assays:

    • Monitor NICD (Notch Intracellular Domain) production in presence/absence of TM2D2

    • Use western blotting to quantify NICD levels

  • Genetic Interaction Studies:

    • Create double mutants with known Notch pathway components

    • Assess enhancement or suppression of phenotypes

  • Structure-Function Analysis:

    • Generate targeted mutations in the conserved DRF motif

    • Test the ability of mutant proteins to rescue neurogenic phenotypes

  • Developmental Assays in Model Organisms:

    • Examine lateral inhibition during neurogenesis

    • Analyze cell fate decisions using lineage markers

These approaches would help delineate the precise mechanism by which TM2D2 regulates Notch signaling and whether its function is conserved from Drosophila to mammals, including primates like Pongo abelii.

How does TM2D2 relate to neurological disorders and what experimental models are appropriate for studying these connections?

While TM2D3 has been directly linked to Alzheimer's disease, the relationship between TM2D2 and neurological disorders requires further investigation:

Current Evidence:

  • TM2D family proteins function together in neuronal development

  • In Drosophila, loss of TM2D genes causes shortened lifespan with progressive motor and electrophysiological defects

  • The functional links between all three TM2D genes are evolutionarily conserved

  • The entire TM2D gene family may be involved in Alzheimer's disease mechanisms

Appropriate Experimental Models:

  • Drosophila Models:

    • TM2D2 knockout flies exhibit age-dependent motor and electrophysiological defects

    • Can be used to study progressive neurological decline

  • Mammalian Cell Culture:

    • Human or primate neuronal cells expressing wild-type or mutant TM2D2

    • iPSC-derived neurons from patients with neurological disorders

  • Mouse Models:

    • Conditional knockout in specific neuronal populations

    • Behavioral and electrophysiological assessments

  • Primate Models:

    • Given the protein is from Pongo abelii, non-human primate models might provide insights into primate-specific functions

    • Comparative studies between human and orangutan TM2D2 function

Experimental Endpoints:

  • Lifespan assessment

  • Motor function tests

  • Electrophysiological recordings

  • Protein aggregation analysis (for AD-related studies)

  • Neuronal morphology and connectivity

These approaches could help establish whether TM2D2, like TM2D3, plays a role in neurodegenerative disorders and whether the mechanisms involve Notch signaling disruption.

What advanced molecular techniques can be used to characterize TM2D2 protein interactions in primate neural tissues?

For studying TM2D2 protein interactions in primate neural tissues:

Proximity-Based Interaction Methods:

  • BioID or TurboID:

    • Fusion of TM2D2 with a biotin ligase to biotinylate proximal proteins

    • Particularly useful for transmembrane proteins like TM2D2

    • Can identify both stable and transient interactions

  • APEX2 Proximity Labeling:

    • Enables subcellular spatially-restricted labeling

    • Useful for mapping interactions within specific cellular compartments

Crosslinking-Based Approaches:

  • Chemical Crosslinking Mass Spectrometry (XL-MS):

    • Can capture transient interactions

    • Provides structural insights into interaction interfaces

  • Photo-Activatable Crosslinking:

    • Site-specific incorporation of photo-crosslinkers

    • High specificity for direct binding partners

Advanced Imaging Techniques:

  • Super-Resolution Microscopy:

    • Track co-localization of TM2D2 with potential partners

    • Particularly powerful when combined with proximity labeling

  • FRET/BRET Analysis:

    • Monitor protein-protein interactions in living cells

    • Useful for studying dynamic interactions

Specialized Pull-Down Methods:

  • MYTH (Membrane Yeast Two-Hybrid):

    • Specifically designed for membrane protein interactions

    • Can be adapted for TM2D2 as a transmembrane protein

  • Co-IP with Specialized Detergents:

    • Use detergents that preserve membrane protein complexes

    • Mass spectrometry analysis of co-precipitated proteins

These techniques can help identify TM2D2 interaction partners in neural tissues, potentially revealing connections to Notch signaling components and other neurologically relevant pathways.

How do knockout studies in model organisms inform our understanding of TM2D2 function in primates?

Knockout studies in model organisms provide valuable insights into TM2D2 function that can be extrapolated to primates:

Drosophila Knockout Findings:

  • TM2D2 (amaretto/CG11103) knockout flies show a maternal-effect neurogenic phenotype

  • Single, double, and triple knockouts with other TM2D genes show similar phenotypes, suggesting functional cooperation

  • Adult flies exhibit shortened lifespan and progressive neurological defects

Translation to Primate Biology:

ParameterDrosophila FindingImplication for Primates
Developmental RoleMaternal-effect neurogenic phenotypeLikely involved in neuronal development through Notch signaling
Functional RedundancySimilar phenotypes across TM2D family knockoutsTM2D family likely works as a functional unit in primates
Adult Neurological FunctionProgressive motor and electrophysiological defectsMay have roles in maintaining neuronal health in adult primates
Notch SignalingActs at γ-secretase cleavage stepSimilar molecular mechanism likely conserved in primates

Methodological Considerations:

  • Evolutionary Context:

    • Consider differences in brain complexity and development

    • Assess conservation of interacting partners between flies and primates

  • Functional Validation:

    • Use genetic rescue experiments with primate TM2D2 in fly models

    • Test whether Pongo abelii TM2D2 can rescue Drosophila phenotypes

  • Comparative Approach:

    • Study the same processes in multiple model systems

    • Compare phenotypes across evolutionary distance

The similarity between fly and human TM2D3 function demonstrated through rescue experiments suggests that findings in Drosophila TM2D2 studies are likely relevant to primate TM2D2 function, particularly in neurological contexts.

What are the structural and functional differences between Pongo abelii TM2D2 and its homologs in other species?

Comparative analysis of TM2D2 across species reveals both conserved and divergent features:

Structural Comparison:

RegionConservation PatternFunctional Implication
Transmembrane domainsHighly conserved across species Critical for membrane localization and function
Intracellular loop with DRF motifHighly conserved Essential for signaling function
Extracellular regionDivergent across species and TM2D family members May confer species-specific interactions
Signal sequencePresent in all speciesRequired for proper membrane targeting

Sequence Homology:

  • Pongo abelii TM2D2 (UniProt: Q5RCC0) shows high similarity to human and other primate TM2D2

  • BLAST analysis reveals strong conservation with vertebrate homologs

  • Moderate conservation with invertebrate orthologs like C. elegans C41D11.9

Functional Conservation and Divergence:

  • The maternal-effect neurogenic phenotype observed in Drosophila knockout models suggests fundamental developmental roles are conserved

  • Species-specific differences may exist in:

    • Tissue expression patterns

    • Regulation of expression

    • Interaction with species-specific binding partners

    • Fine-tuning of signaling pathways

Evolutionary Significance:

  • The conservation of TM2D2 structural elements from invertebrates to primates indicates strong evolutionary pressure to maintain function

  • Divergence in extracellular domains may reflect adaptation to species-specific signaling environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.