Recombinant Pongo abelii Torsin-1A-interacting protein 1 (TOR1AIP1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TOR1AIP1; Torsin-1A-interacting protein 1; Lamina-associated polypeptide 1B; LAP1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MAGEGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTSLSRQGRREVRFS
DEPPEVYGDFEPLVDKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQEAE
EMKTRRTTRLQQQHSQQPPLQPSPVMTRRGLRDSHSSEEDEPSSPTDLSQTISKKTVRSI
QEAPAESEDLVISLRRPPLRYPRSEATSVQQKVNFSEEGETEDDQDSSHSSVTTVKSRSR
DSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARMRTR
MQTSSPGKSSIYGSFSDDDSILKSELGNQSPSTSSQQVTGQPQNASFVKRNWWWLLPLIA
ALASGSFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRS
QPAILLLTAARDAEEALRCLSEQIADAYSSFHSVRAIRIDGTDKATQDSDTVKLEVDQEL
SNGLKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGL
KEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL
Uniprot No.
Target Background
Function
Essential for nuclear membrane integrity. It induces TOR1A and TOR1B ATPase activity and is crucial for their nuclear membrane localization. It binds to A- and B-type lamins, suggesting a role in membrane attachment and nuclear lamina assembly.
Database Links
KEGG: pon:100173369
STRING: 9601.ENSPPYP00000000522
Protein Families
TOR1AIP family
Subcellular Location
Nucleus inner membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
