Recombinant Pongo abelii Translocation protein SEC62 (SEC62)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SEC62; TLOC1; Translocation protein SEC62; Translocation protein 1; TP-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-399
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKE EDKKSKKENIKDEKTKKEKEKKKDGEKEDSKKEETPGTPKKKETKKKFKLEPHDDQVFLD GNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGLGGERHSDTDSDRREDDRSQHSSGNG NDFEMITKEELEQQTDGDCEEEEEEENDGETPKSSHEKS
Uniprot No.

Target Background

Function
Recombinant Pongo abelii Translocation protein SEC62 (SEC62) mediates the post-translational transport of precursor polypeptides across the endoplasmic reticulum (ER). It is proposed to function as a targeting receptor for small presecretory proteins containing short, apolar signal peptides. SEC62 targets and precisely positions newly synthesized presecretory proteins within the SEC61 channel-forming translocon complex, initiating channel opening for polypeptide translocation into the ER lumen.
Database Links
Protein Families
SEC62 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SEC62 and what is its functional role in protein translocation?

SEC62 is an essential component of the Sec complex responsible for posttranslational protein translocation across the endoplasmic reticulum (ER) membrane. It functions by binding to the Sec complex via its cytosolic N- and C-terminal domains, with the N-terminal domain serving as the major interaction site that binds directly to the last 14 residues of Sec63p . The C-terminal binding site of SEC62, while less critical for complex stability, is positioned adjacent to regions potentially involved in signal sequence recognition . In eukaryotes, SEC62 works cooperatively with other components of the specialized channel including Sec61, Sec63, Sec71, and Sec72 subunits to facilitate post-translational protein transport .

The functional significance of SEC62 is underscored by its role in recognizing fully synthesized proteins destined for secretion or membrane insertion, distinguishing it from co-translational pathways where ribosomes are directly involved in the translocation process . Recent structural studies have revealed that SEC62's transmembrane helices help stabilize the lateral gate of the Sec61 complex when bound to a signal sequence .

How does the structure of Pongo abelii SEC62 compare to its homologs in other species?

While specific structural data for Pongo abelii SEC62 remains limited compared to well-characterized yeast models, comparative analysis allows us to make informed inferences. The SEC62 protein is highly conserved across eukaryotes, with the functional domains maintaining significant homology.

Based on available structural data from yeast (Saccharomyces cerevisiae), SEC62 contains critical cytosolic domains at both the N- and C-termini that facilitate binding to the Sec complex, with two transmembrane segments connecting these regions . Recent crystallographic studies have revealed that the N-terminal cytosolic domain of SEC62 has a novel fold that interacts with the phosphorylated C-terminal peptide of Sec63 . While this information derives from yeast studies, the high conservation of protein translocation machinery suggests similar structural arrangements in Pongo abelii.

The following table summarizes key structural features expected in Pongo abelii SEC62 based on homology with characterized SEC62 proteins:

Structural FeatureFunctionConservation Level
N-terminal cytosolic domainPrimary binding site for Sec63 interactionHigh
C-terminal cytosolic domainSecondary binding site, signal sequence proximityModerate-High
Two transmembrane helicesLateral gate stabilization, membrane anchoringHigh
Signal sequence binding regionSubstrate recognitionModerate

What methodologies are recommended for initial characterization of recombinant Pongo abelii SEC62?

Initial characterization should employ a multi-faceted approach combining structural, functional, and interaction analyses:

  • Structural characterization: Circular dichroism spectroscopy provides information about secondary structure composition. For higher resolution structural data, X-ray crystallography of the purified cytosolic domains can be pursued following the methods demonstrated in recent SEC62 cytosolic domain crystallization studies .

  • Functional assays: In vitro translocation assays using reconstituted proteoliposomes containing recombinant SEC62 and other Sec complex components. Success can be measured by the translocation efficiency of model substrates with known signal sequences.

  • Interaction mapping: Co-immunoprecipitation and pull-down assays to identify binding partners, particularly focusing on interactions with Sec63p, as the N-terminal domain of SEC62 is known to bind directly to the last 14 residues of Sec63p .

  • Membrane topology analysis: Protease protection assays and site-specific labeling to confirm the predicted transmembrane orientation, particularly important given SEC62's role in stabilizing the lateral gate of the Sec61 complex .

  • Comparative analysis: Alignment with well-characterized SEC62 proteins from other species to identify conserved and divergent features that might reflect Pongo abelii-specific adaptations.

What are the optimal expression systems for producing functional recombinant Pongo abelii SEC62?

The selection of an expression system for recombinant Pongo abelii SEC62 requires careful consideration of the protein's structural complexity and functional requirements. Based on successful strategies for expressing other membrane-associated translocation components:

Eukaryotic expression systems are generally preferred due to their capacity for appropriate post-translational modifications and membrane protein folding. Specifically:

  • Yeast expression systems: Saccharomyces cerevisiae or Pichia pastoris offer advantages for expressing Pongo abelii SEC62 due to the evolutionary conservation of the Sec machinery. The promoter selection is critical - galactose-inducible promoters (P<sub>GAL1</sub>) or copper-inducible promoters (P<sub>CUP1</sub>) have been successfully used for SEC62 expression in yeast systems .

  • Insect cell expression: Baculovirus-infected insect cells provide a eukaryotic environment capable of proper folding and post-translational modifications while offering higher protein yields than yeast systems.

  • Mammalian cell expression: For studies requiring the highest degree of native-like protein, mammalian cell lines (particularly primate-derived lines) may be optimal despite lower yields.

When designing expression constructs, attention should be paid to:

  • Inclusion of appropriate affinity tags (preferably at the C-terminus to avoid interfering with the critical N-terminal domain interactions with Sec63)

  • Codon optimization for the expression host

  • Signal sequence considerations if secretion is desired

  • Temperature and induction conditions optimization (lower temperatures often improve membrane protein folding)

How can researchers effectively analyze the interaction between recombinant SEC62 and other components of the Sec complex?

Analyzing SEC62 interactions with other Sec complex components requires a combination of in vitro and in vivo approaches:

  • In vivo competition assay: This approach has proven effective for characterizing physical and functional interactions between SEC62 and components of the Sec complex . The method involves expressing fragments of SEC62 to compete with the endogenous protein for binding to partners, thereby revealing functional interaction sites.

  • Split-ubiquitin assay: This technique is particularly useful for membrane protein interactions and has been successfully employed for SEC62 interaction studies. It involves fusing the N-terminal part of ubiquitin (N<sub>ub</sub>) to one protein and the C-terminal part to another potential interaction partner. Proximity-dependent ubiquitin reconstitution leads to reporter activation .

  • Cryo-electron microscopy: Recent advances have enabled visualization of the entire Sec complex with bound substrates. This technique revealed that the signal sequence binds to the lateral gate of Sec61 while being stabilized by the transmembrane helices of the SEC62 subunit .

  • Site-directed mutagenesis and functional rescue: Systematic mutation of key residues in recombinant Pongo abelii SEC62 followed by functional complementation in SEC62-deficient systems can map critical interaction interfaces.

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC): These biophysical techniques enable quantitative measurement of binding affinities between purified SEC62 domains and partner proteins, particularly useful for characterizing the interaction between the N-terminal domain of SEC62 and the C-terminal peptide of Sec63 .

What approaches can be used to investigate the role of SEC62 in signal sequence recognition?

Signal sequence recognition is a critical function potentially associated with the C-terminal domain of SEC62 . To investigate this role in Pongo abelii SEC62:

  • Crosslinking studies: Chemical crosslinking combined with mass spectrometry can identify proximity relationships between SEC62 domains and signal sequences during translocation.

  • Mutational analysis: Systematic mutation of the putative signal sequence binding region followed by functional assays can identify residues critical for substrate recognition.

  • Comparative structural biology: Cryo-EM structures of the Sec complex with and without bound substrate reveal conformational changes associated with signal sequence binding. The signal sequence has been observed to insert into the lateral gate of Sec61α, with SEC62 transmembrane helices providing stabilization .

  • Fluorescence resonance energy transfer (FRET): By labeling SEC62 and various signal sequences with appropriate fluorophores, researchers can detect direct interactions and conformational changes during the recognition process.

  • Substrate specificity profiling: Using diverse signal sequences with varying hydrophobicity, charge distribution, and length can identify the sequence features preferentially recognized by Pongo abelii SEC62 compared to SEC62 from other species.

It's important to note that recent structural studies suggest a model where the signal sequence binds the lateral gate of the Sec61 complex, which is then stabilized by the transmembrane helices of SEC62 . This indicates a more complex role for SEC62 in signal sequence handling than direct binding alone.

How can researchers troubleshoot expression and purification issues with recombinant Pongo abelii SEC62?

Common challenges and solutions in recombinant SEC62 expression and purification include:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Reduce expression temperature to 16-20°C to improve folding

    • Co-express with molecular chaperones if using prokaryotic systems

  • Protein aggregation:

    • Screen detergents for membrane extraction (typically start with mild detergents like DDM, LMNG, or digitonin)

    • Add stabilizing ligands during purification

    • Consider expression of individual domains rather than the full-length protein

    • Use fusion partners that enhance solubility

  • Poor membrane integration:

    • Verify signal sequence function if using a heterologous secretion system

    • Test expression in eukaryotic systems with robust ER membranes

    • Consider co-expression with other Sec complex components

  • Proteolytic degradation:

    • Include protease inhibitors during all purification steps

    • Minimize purification time and maintain samples at 4°C

    • Identify and mutate protease-sensitive sites that are not essential for function

  • Low purity:

    • Implement multi-step purification strategies combining affinity chromatography with size exclusion and/or ion exchange

    • Use on-column detergent exchange to improve protein stability

    • Consider using tandem affinity tags to increase specificity

  • Loss of function during purification:

    • Validate function at each purification step

    • Supplement buffers with lipids to maintain a native-like environment

    • Consider reconstitution into nanodiscs or liposomes immediately after initial purification

What methodologies can be employed to study the structure-function relationship of Pongo abelii SEC62?

Investigating structure-function relationships requires integrating structural biology with functional assays:

  • Structural analysis techniques:

    • Cryo-electron microscopy has successfully revealed the structure of the yeast Sec complex with bound substrate, showing how SEC62 transmembrane helices stabilize the lateral gate of Sec61α

    • X-ray crystallography has been used to determine the structure of the SEC62 cytosolic domain, revealing a novel fold that interacts with the phosphorylated C-terminal peptide of Sec63

    • NMR spectroscopy can provide dynamic information about isolated soluble domains

  • Functional mapping through mutagenesis:

    • Alanine scanning mutagenesis of conserved residues

    • Domain deletion or swapping between species to identify species-specific functional elements

    • Introduction of temperature-sensitive mutations by reference to known sec62 mutants like sec62-1

  • In vivo complementation assays:

    • Test whether recombinant Pongo abelii SEC62 can functionally replace endogenous SEC62 in yeast systems

    • Analyze complementation efficiency with wild-type versus mutant variants

  • Domain-specific functional assays:

    • For the N-terminal domain: binding assays with the C-terminal peptide of Sec63

    • For the C-terminal domain: signal sequence binding or recognition assays

    • For transmembrane domains: lateral gate stabilization and membrane integration assays

  • Molecular dynamics simulations:

    • Predict conformational changes during substrate binding

    • Analyze water and ion movements through the translocation channel

    • Model interactions with other Sec complex components

How should researchers interpret differences in SEC62 function between species?

Interpreting interspecies functional differences requires a systematic comparative approach:

  • Sequence homology analysis:

    • Align SEC62 sequences from multiple species, focusing on primates, other mammals, and model organisms

    • Identify conserved motifs versus species-specific variations

    • Map variations to functional domains based on structural data

  • Structural implications:

    • Model the Pongo abelii SEC62 structure based on available structures such as the yeast SEC62 cytosolic domain

    • Predict how amino acid differences might impact interactions with other Sec complex components

    • Analyze conservation of the binding interface with Sec63, which has been mapped to the last 14 residues in yeast

  • Functional correlation:

    • Compare substrate specificity profiles between species

    • Analyze differences in binding affinities for partner proteins

    • Evaluate differences in post-translational modification patterns

  • Evolutionary context:

    • Consider the cellular environment and secretory demands in different species

    • Evaluate whether differences correlate with specific physiological adaptations

    • Use phylogenetic analysis to distinguish ancestral from derived features

  • Statistical approaches:

    • When comparing functional parameters between species, employ appropriate statistical tests based on data distribution

    • Use multiple sequence alignment tools with position-specific scoring matrices

    • Consider Bayesian approaches for integrating structural and functional data

A systematic analysis framework might include:

Analysis LevelMethodsInterpretation Approach
Primary sequenceMultiple sequence alignment, conservation scoringIdentify invariant residues vs. species-specific variations
Secondary/tertiary structureHomology modeling, structural alignmentMap variations to functional surfaces and interfaces
Protein-protein interactionsBinding assays, crosslinking, co-IPCompare interaction networks across species
Cellular functionComplementation assays, translocation efficiencyQuantify functional differences in standardized systems
Physiological contextExpression pattern analysis, tissue specificityRelate to species-specific secretory demands

What are the critical controls needed when studying recombinant SEC62 functionality?

Robust experimental design requires comprehensive controls:

  • Positive controls:

    • Well-characterized SEC62 from model organisms (e.g., yeast SEC62) with established functionality

    • Native Sec complex preparations to establish baseline activity

    • Known SEC62 substrates with validated translocation requirements

  • Negative controls:

    • SEC62 with mutations in critical functional residues (e.g., Sec63 binding site)

    • SEC62 with truncated domains

    • Translocation substrates lacking signal sequences

  • System validation controls:

    • Verification of proper membrane topology for recombinant SEC62

    • Confirmation of complex formation with other Sec components

    • Assessment of lipid composition effects on activity

  • Comparative controls:

    • Parallel analysis of co-translational (SEC62-independent) and post-translational (SEC62-dependent) substrates

    • Comparison of different expression systems for the same construct

    • Side-by-side testing of tagged versus untagged proteins to assess tag interference

  • Reproducibility controls:

    • Technical replicates to assess method reliability

    • Biological replicates using independent protein preparations

    • Inter-laboratory validation when possible

How can researchers effectively integrate structural and functional data for comprehensive understanding of Pongo abelii SEC62?

Integrating structural and functional data requires a multi-dimensional approach:

  • Structure-guided functional analysis:

    • Map functional data onto structural models to visualize activity hotspots

    • Design targeted mutations based on structural features for functional testing

    • Use structural information to guide crosslinking and proximity labeling experiments

  • Data visualization techniques:

    • Create interactive structural models highlighting functional domains

    • Develop heat maps correlating sequence conservation with functional importance

    • Generate protein interaction networks with structural constraints

  • Integrative computational approaches:

    • Molecular dynamics simulations incorporating experimental constraints

    • Machine learning models trained on combined structural and functional datasets

    • Evolutionary covariance analysis to identify co-evolving residues

  • Multi-scale experimental integration:

    • Correlate atomic-level structural data with cellular-level functional outcomes

    • Link biophysical measurements (binding affinities, conformational changes) with physiological effects

    • Incorporate time-resolved data to understand dynamic aspects of SEC62 function

  • Collaborative frameworks:

    • Establish data sharing platforms combining structural and functional datasets

    • Develop standardized protocols for comparative analysis across laboratories

    • Implement common benchmarks for functional assays

The recent integration of cryo-EM structural data with in vitro functional assays has significantly advanced understanding of the Sec complex . Similar approaches can be applied to Pongo abelii SEC62, where structural features like the novel fold of the N-terminal cytosolic domain can be directly linked to functional roles such as binding the phosphorylated C-terminus of Sec63 .

What emerging technologies might advance our understanding of Pongo abelii SEC62 function?

Several cutting-edge approaches hold promise for deeper insights into SEC62 biology:

  • Cryo-electron tomography: This technique could visualize the native Sec complex in intact cellular membranes, providing insights into the physiological organization and dynamics impossible to capture with isolated components .

  • Single-molecule techniques: Methods such as single-molecule FRET and optical tweezers could reveal the conformational dynamics and force generation during SEC62-mediated translocation events.

  • In-cell structural biology: Techniques like in-cell NMR and proximity labeling could capture SEC62 structural states and interactions within the native cellular environment.

  • AlphaFold and other AI-based structure prediction: These approaches could model species-specific structural features of Pongo abelii SEC62 and predict functional interactions even in the absence of experimental structures.

  • High-throughput substrate profiling: Next-generation sequencing coupled with ribosome profiling could identify the complete substrate repertoire of SEC62-dependent translocation in various cell types.

  • Organoid models: Pongo abelii-derived organoids could provide physiologically relevant systems to study SEC62 function in the context of orangutan-specific cellular physiology.

  • Genome editing in relevant models: CRISPR/Cas9 engineering could create precise mutations in SEC62 to study function in cellular contexts more closely related to Pongo abelii.

How might comparative studies between human and Pongo abelii SEC62 advance biomedical research?

Comparative studies offer unique insights with translational potential:

  • Evolutionary insights: Differences between human and orangutan SEC62 may reveal adaptive changes related to species-specific secretory demands or environmental adaptations.

  • Disease-relevant variations: Comparing disease-associated mutations in human SEC62 with corresponding sites in Pongo abelii SEC62 could reveal protective mechanisms or alternative functional pathways.

  • Substrate specificity differences: Variations in SEC62 might contribute to species-specific protein secretion profiles relevant to understanding human-specific disease susceptibilities.

  • Therapeutic target validation: Functional sites conserved between humans and orangutans would represent evolutionarily constrained regions that might serve as robust therapeutic targets.

  • Model system development: Understanding the degree of functional conservation could validate the use of non-human primate cell lines as models for studying SEC62-related human diseases.

Such comparative approaches would be particularly valuable given the phylogenetic proximity of orangutans to humans, offering insights into primate-specific adaptations of the protein translocation machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.