Recombinant Pongo abelii Translocation protein SEC63 homolog (SEC63)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Translocation protein SEC63 homolog from Pongo abelii is a critical component of the protein translocation machinery. The protein consists of 761 amino acids with an expression region spanning positions 2-761, representing the full-length mature protein . In scientific databases, this protein is identified under the UniProt accession number Q5R660 . The gene encoding this protein is designated as SEC63, consistent with its homologs across species .

Expression Systems

Recombinant Pongo abelii SEC63 is primarily produced using cell-free expression systems according to commercial supplier information . This approach offers advantages in expressing complex transmembrane proteins like SEC63, which might be challenging to produce in traditional cellular systems. The cell-free expression approach bypasses the limitations of cell viability and membrane insertion constraints, potentially yielding higher quantities of functional protein for research applications.

Purification and Quality Control

Commercial preparations of recombinant Pongo abelii SEC63 protein typically achieve a purity of greater than or equal to 85% as determined by SDS-PAGE analysis . This level of purity is sufficient for most research applications, including immunological studies, functional assays, and structural investigations. The purification process, while not detailed specifically in the available sources, likely employs standard chromatographic techniques optimized for maintaining the protein's native conformation and functional integrity.

Role in Protein Translocation

SEC63 plays a critical role in the cellular protein translocation machinery, specifically involved in the transport of proteins across the endoplasmic reticulum (ER) membrane. The protein operates as part of the SEC complex, which facilitates the translocation of newly synthesized proteins into the ER lumen or their insertion into the ER membrane. This process represents a fundamental aspect of the secretory pathway in eukaryotic cells and is essential for proper protein targeting and trafficking.

Comparisons with mouse SEC63 homolog, which spans a similar amino acid range (2-760), suggest high functional conservation across mammalian species . This evolutionary conservation underscores the fundamental importance of the SEC63 protein in cellular protein trafficking mechanisms.

Research Applications

Recombinant Pongo abelii SEC63 has multiple potential applications in biochemical and cell biological research contexts:

  1. Investigation of protein translocation mechanisms across the ER membrane

  2. Comparative studies of translocation machinery components between primate and non-primate species

  3. Development of antibodies and immunological reagents for SEC63 detection

  4. In vitro reconstitution experiments examining protein translocation processes

  5. Structure-function analyses of SEC63 domains and their roles in translocation

The availability of purified recombinant SEC63 enables researchers to conduct controlled experiments that would be challenging or impossible with endogenous protein alone.

Comparative Studies

The SEC63 protein functions in concert with other components of the translocation machinery. Related proteins available for comparative studies include SEC62 (translocation protein SEC62) from Pongo abelii , providing opportunities for comprehensive analysis of the translocation apparatus. Additionally, comparison with the mouse homolog (spanning amino acids 2-760) enables evolutionary and functional studies across mammalian lineages .

Stability and Reconstitution Guidelines

Several important handling guidelines should be followed when working with recombinant Pongo abelii SEC63:

  1. Repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of activity

  2. Creating working aliquots is recommended to minimize the number of freeze-thaw cycles

  3. The protein should be maintained in appropriate buffer conditions to preserve its native conformation

  4. Care should be taken to avoid proteolytic degradation through proper handling techniques and inclusion of protease inhibitors when necessary

These guidelines help ensure the maintenance of protein structure and function throughout experimental procedures, maximizing research value and reproducibility.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please specify your preference in the order notes. We will prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice, please notify us in advance. Additional fees will apply for dry ice shipping.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
SEC63; Translocation protein SEC63 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-761
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
AGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYRL RLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEIK KQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA WIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRNM DMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLKA RVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIVMARNREEREFRAPTLA SLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDRH TLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMAE VFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAKSKKKKKPLKKKPTPVL LPQSKQQKQKQANGVVGNEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE QDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKE QTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK PVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD
Uniprot No.

Target Background

Function
SEC63, a Translocation protein homolog from Pongo abelii, plays a critical role in the cotranslational and post-translational transport of certain precursor polypeptides across the endoplasmic reticulum (ER). It is proposed to assist in recognizing precursors with short, apolar signal peptides. In collaboration with SEC62 and HSPA5/BiP, SEC63 may facilitate the targeting of small presecretory proteins into the SEC61 channel-forming translocon complex, triggering channel opening for polypeptide translocation into the ER lumen. SEC63 is essential for the efficient biogenesis and trafficking of PKD1/Polycystin-1 to the plasma membrane of the primary cilia.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological function of SEC63 in Pongo abelii?

SEC63 in Pongo abelii functions as a critical component of the protein translocation machinery in the endoplasmic reticulum (ER) membrane. Based on homology with other mammalian systems and the well-characterized yeast SEC63, this protein works in concert with SEC61 and SEC62 to facilitate post-translational protein import into the ER lumen. The protein contains transmembrane domains that anchor it in the ER membrane, with functional domains extending into both the cytosol and ER lumen . To study this function in Pongo abelii specifically, researchers should design experiments comparing its activity with that of human and other primate SEC63 homologs, particularly focusing on its interaction with the SEC61 channel to mediate protein gating mechanisms.

How does the structure of Pongo abelii SEC63 compare to other primates?

Pongo abelii SEC63 shares significant structural homology with other primate SEC63 proteins, particularly in the conserved functional domains. Based on homology modeling approaches:

DomainConservation LevelKey Structural Features
Transmembrane domainsHighly conservedContains multiple TM segments similar to yeast SEC63 (TM1, TM2, and TM3)
J-domainHighly conservedCrucial for interaction with luminal chaperones
Brr2-like domainModerately conservedInvolved in nucleotide binding
C-terminal regionLess conservedSpecies-specific variations may affect regulatory functions

To properly characterize structural differences, researchers should employ comparative structural biology approaches including protein crystallography or cryo-EM studies to determine if the gating mechanism observed in fungal systems (where SEC63 works hierarchically with SEC62 to activate SEC61) is conserved in Pongo abelii.

What expression patterns of SEC63 are observed across Pongo abelii tissues?

While specific expression data for SEC63 in Pongo abelii tissues is limited, researchers can design RT-qPCR experiments targeting conserved regions of the SEC63 transcript across multiple orangutan tissues. Based on extrapolation from human studies, SEC63 is likely expressed in most tissues with potentially higher expression in secretory tissues. Researchers investigating this question should:

  • Collect tissue samples from multiple organs of Pongo abelii (when ethically available)

  • Extract total RNA using standard protocols

  • Perform RT-qPCR with primers designed against conserved regions

  • Normalize expression against established housekeeping genes

  • Compare expression patterns with data from other primates to identify potential species-specific differences

Expression analysis should be correlated with physiological and developmental stages, as maternal care behaviors in Pongo abelii suggest complex developmental patterns that may influence protein expression across life stages .

How do mutations in Pongo abelii SEC63 affect protein translocation efficiency?

To investigate the effects of mutations in Pongo abelii SEC63 on protein translocation efficiency, researchers should:

  • Generate recombinant wild-type and mutant versions of Pongo abelii SEC63

  • Reconstitute the protein translocation machinery in vitro using purified components

  • Measure translocation efficiency using reporter substrates

Mutation TypeExpected EffectExperimental Approach
J-domain mutationsDisrupted interaction with chaperonesIn vitro binding assays with luminal chaperones
Transmembrane domain mutationsAltered membrane insertion or gatingCryo-EM structural analysis of channel conformations
C-terminal mutationsPotential regulatory defectsFunctional assays measuring translocation kinetics

When analyzing results, researchers should consider that SEC63 works in hierarchical coordination with SEC62 to activate the SEC61 channel for post-translational protein translocation . Mutations may disrupt this coordinated action, particularly at the interaction interfaces between these proteins.

What is the molecular interaction mechanism between Pongo abelii SEC63 and SEC61?

The molecular interaction between Pongo abelii SEC63 and SEC61 likely involves a regulated gating mechanism similar to that observed in fungal systems. Based on structural studies of the yeast complex, SEC63 interacts with the SEC61 channel to facilitate lateral gate opening . To investigate this specific interaction in Pongo abelii:

  • Perform co-immunoprecipitation studies using antibodies against conserved epitopes

  • Conduct cryo-EM analysis of the assembled complex

  • Use crosslinking mass spectrometry to identify interaction interfaces

The hierarchical activation model suggests that SEC63 and SEC62 work together to regulate different aspects of SEC61 channel gating. This coordination appears to involve conformational changes that propagate from SEC63 through SEC62 to the lateral gate of SEC61 . Researchers should design experiments to test whether this model is conserved in Pongo abelii, particularly focusing on whether the conformational transitions observed in the C1 to C2 states in yeast occur similarly in the primate system.

How does orangutan maternal behavior affect SEC63 regulation during development?

This question bridges molecular biology with behavioral ecology, connecting SEC63 function to broader orangutan biology. While direct evidence linking SEC63 regulation to maternal behavior is not established, researchers could design studies exploring this connection:

  • Collect tissue samples (when ethically available) from offspring at different developmental stages

  • Compare SEC63 expression levels and post-translational modifications across developmental timepoints

  • Correlate these molecular changes with documented maternal care behaviors

Sumatran orangutan offspring begin consistently feeding on solid food from approximately 1 year of age and acquire skills through both individual and social learning, primarily by observing their mothers . This developmental transition may correlate with changes in secretory pathway regulation, potentially involving SEC63. Since male orangutans start dispersing during adolescence while females remain in natal areas , researchers could investigate whether SEC63 expression or function shows sex-specific differences that might relate to these divergent developmental trajectories.

What are the optimal conditions for expressing recombinant Pongo abelii SEC63?

For successful expression of recombinant Pongo abelii SEC63, researchers should consider:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO) provide proper post-translational modifications

    • Insect cell systems (Sf9, Hi5) offer good compromise between yield and proper folding

    • Bacterial systems may be suitable for domain fragments but challenging for full-length protein

  • Construct design considerations:

    • Include appropriate affinity tags (His, FLAG) for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Engineer removable tags using specific proteases (TEV, PreScission)

Expression SystemAdvantagesLimitationsRecommended Protocol Adjustments
HEK293Native-like PTMsLower yieldOptimize transfection conditions, use stable cell lines
Sf9/BaculovirusHigher yield, proper foldingMore complex setupOptimize MOI, harvest timing
E. coliHighest yield, simplest setupChallenging for membrane proteinsUse specialized strains, lower induction temperature

For membrane protein expression, detergent screening is crucial. Start with a panel including DDM, LMNG, and GDN for extraction, and consider reconstitution into nanodiscs or liposomes for functional studies.

How can researchers effectively study SEC63-mediated protein translocation in vitro?

To study SEC63-mediated protein translocation in vitro, researchers should establish a reconstituted system:

  • Purify recombinant Pongo abelii SEC63, SEC61 complex, and SEC62

  • Reconstitute these components into proteoliposomes

  • Prepare radiolabeled or fluorescently labeled translocation substrates

  • Measure translocation efficiency under various conditions

The assay should include:

  • ATP and GTP as energy sources

  • Appropriate chaperone systems (cytosolic and luminal)

  • Control experiments with known inhibitors of translocation

Analysis should focus on both kinetics and efficiency of translocation, comparing wild-type SEC63 with mutant variants. Researchers should be attentive to the conformational states observed in cryo-EM studies, where SEC63 appears to regulate the lateral gate of SEC61 through specific interactions .

What approaches can determine evolutionary conservation of SEC63 function across primates?

To investigate evolutionary conservation of SEC63 function across primates, researchers should employ:

  • Comparative genomics:

    • Sequence alignment of SEC63 orthologs from diverse primate species

    • Calculation of selection pressures (dN/dS) across different domains

    • Identification of primate-specific conserved elements

  • Functional complementation studies:

    • Test whether Pongo abelii SEC63 can rescue defects in cells depleted of endogenous SEC63

    • Compare rescue efficiency across SEC63 orthologs from different primates

    • Identify domains responsible for species-specific functions through chimeric constructs

  • Structural biology:

    • Perform comparative structural analysis of SEC63 from different primates

    • Focus on interaction interfaces with SEC61 and SEC62

    • Identify structural adaptations specific to different primate lineages

This approach should be integrated with developmental biology perspectives, considering that Pongo abelii offspring learn crucial foraging skills from their mothers during extended developmental periods . The molecular machinery supporting this knowledge transfer may show evolutionary adaptations specific to orangutan life history.

How can researchers optimize antibody development for Pongo abelii SEC63 studies?

Developing specific antibodies for Pongo abelii SEC63 requires careful epitope selection:

  • Epitope selection strategy:

    • Identify regions unique to Pongo abelii SEC63 compared to other primates

    • Target accessible regions based on structural predictions

    • Develop multiple antibodies against different epitopes

  • Validation approaches:

    • Western blotting against recombinant protein

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence in cells expressing tagged constructs

    • Testing cross-reactivity with SEC63 from other species

  • Application-specific considerations:

    • For structural studies, epitopes should not interfere with protein-protein interactions

    • For functional assays, consider whether antibodies affect translocation activity

    • For tissue studies, optimize fixation conditions to preserve epitope accessibility

What data analysis approaches best characterize SEC63 functional variations?

To effectively analyze SEC63 functional data:

  • Kinetic analysis:

    • Apply Michaelis-Menten kinetics to translocation assays

    • Use global fitting approaches for complex reaction schemes

    • Compare kinetic parameters (kcat, Km) across different SEC63 variants

  • Structural data integration:

    • Correlate functional differences with structural variations

    • Use molecular dynamics simulations to predict functional impacts

    • Integrate cryo-EM conformational states with functional outcomes

  • Evolutionary analysis:

    • Apply phylogenetic approaches to identify functional shifts

    • Use ancestral sequence reconstruction to study evolutionary trajectories

    • Correlate molecular evolution with ecological adaptations

When interpreting results, researchers should consider that conformational transitions in SEC63 appear to propagate to the SEC61 channel, affecting lateral gate opening . Analysis should focus on these dynamic aspects rather than static structural features.

How should researchers design comparative studies between human and Pongo abelii SEC63?

For effective comparative studies:

  • Experimental design considerations:

    • Use identical experimental conditions for both orthologs

    • Express proteins in the same cellular background

    • Include appropriate controls for species-specific factors

  • Functional comparison approach:

    • Compare substrate specificity profiles

    • Analyze interaction networks through proteomics

    • Assess post-translational modification patterns

  • Data interpretation framework:

    • Distinguish conserved core functions from species-specific adaptations

    • Consider the evolutionary distance between humans and orangutans

    • Relate molecular differences to physiological adaptations

This comparative approach should consider that Pongo abelii has specific ecological adaptations, including maternal care behaviors that facilitate knowledge transfer to offspring . These adaptations may be reflected in molecular mechanisms including SEC63 function, particularly in tissues involved in cognitive development and food processing.

How might SEC63 function contribute to orangutan-specific adaptations?

SEC63's role in protein translocation may contribute to orangutan-specific adaptations through:

  • Tissue-specific expression patterns that support unique physiological requirements

  • Potential variations in substrate specificity affecting secretory pathway function

  • Altered regulatory mechanisms that may correlate with developmental transitions

Researchers investigating this question should design comparative studies examining SEC63 function across different primate species, with particular attention to tissues undergoing orangutan-specific adaptations. Since maternal behavior in Sumatran orangutans is modulated by socioecological factors , researchers might investigate whether SEC63 function in brain or mammary tissue shows orangutan-specific features that could support these behavioral adaptations.

What technological advances would most benefit Pongo abelii SEC63 research?

Future research on Pongo abelii SEC63 would benefit most from:

  • Development of orangutan-derived cell lines that maintain species-specific cellular context

  • Cryo-EM structural determination of the complete Pongo abelii Sec complex

  • Advanced genetic tools for manipulating SEC63 in relevant model systems

  • Non-invasive approaches for studying protein function in endangered species

These technological advances should be developed with consideration for the endangered status of Sumatran orangutans, prioritizing approaches that maximize information while minimizing impact on wild populations.

How does SEC63 function integrate with broader studies of orangutan biology and conservation?

SEC63 research can be integrated with broader orangutan biology through:

  • Connecting molecular function to physiological adaptations

  • Understanding how SEC63 variants might affect health and resilience

  • Establishing molecular markers for population studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.