Recombinant Pongo abelii Translocon-associated protein subunit gamma (SSR3)

Shipped with Ice Packs
In Stock

Description

Biological Role of SSR3

SSR3 is part of the TRAP complex (TRAPα, β, γ, δ), which stabilizes the Sec61 translocon and regulates calcium retention in the ER ( ). Key findings:

  • Mechanistic Role: SSR3 binds ribosomes and positions itself below the translocon to interact with nascent polypeptides, influencing their folding and secretion ( ).

  • Disease Relevance:

    • High SSR3 levels correlate with paclitaxel sensitivity in breast cancer and glioblastoma by modulating ER stress sensor IRE1α phosphorylation ( ).

    • Mutations in SSR3 are linked to congenital disorders of glycosylation ( ).

Research Applications

Recombinant Pongo abelii SSR3 is utilized in:

  • Protein-Protein Interaction Studies: Mapping TRAP complex architecture via cryo-EM ( ).

  • Drug Response Biomarker Screening: SSR3 expression predicts paclitaxel efficacy in cancer models ( ).

  • ER Stress Pathways: Investigating IRE1α signaling and unfolded protein response ( ).

Comparative Analysis Across Species

SSR3 homologs are conserved but exhibit species-specific variations:

SpeciesExpression SystemKey FeaturesReference
Mus musculus (Mouse)HEK293TMyc/DDK-tagged; regulates ER calcium retention
Macaca fascicularisMammalian cellsHis-tagged; custom production for functional assays
Homo sapiensHEK293Linked to chemotherapy response and ER stress

Technical Considerations

  • Production Challenges: Custom production of Pongo abelii SSR3 requires 5–9 weeks due to low natural abundance ( ).

  • Functional Assays: Activity is validated via ELISA/Western blot for binding to Sec61 or ribosomes ( ).

Future Directions

  • Clinical Translation: Prospective validation of SSR3 as a biomarker for taxane-based therapies ( ).

  • Structural Studies: High-resolution mapping of TRAP-ribosome interfaces using cryo-EM ( ).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
SSR3; Translocon-associated protein subunit gamma; TRAP-gamma; Signal sequence receptor subunit gamma; SSR-gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MAPKGSCKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK
Uniprot No.

Target Background

Function
TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane, thereby regulating the retention of ER resident proteins.
Database Links
Protein Families
TRAP-gamma family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How can I design primers for amplifying Pongo abelii SSR3 gene sequences?

When designing primers for Pongo abelii SSR3 amplification, follow these methodological guidelines:

  • Obtain the reference sequence from genomic databases and analyze for unique regions

  • Design primers with the following parameters:

    • Primer size: 20-22 base pairs

    • GC content: 40-60%

    • Melting temperature: 55-65°C

    • Expected product size: 100-500 base pairs

This approach aligns with established protocols for primer design in related species . For optimal results, confirm specificity using online BLAST services to ensure primers don't amplify non-target regions. Tools like Primer3 can facilitate design with these parameters, and custom scripts can be developed for high-throughput applications similar to those used in SSR identification systems .

What expression systems are most appropriate for recombinant production of Pongo abelii SSR3?

The selection of an expression system for recombinant Pongo abelii SSR3 production should be based on experimental objectives and downstream applications. For structural studies requiring post-translational modifications, mammalian systems (CHO or HEK293) typically yield better results than bacterial systems. For functional studies, insect cell systems (Sf9, Sf21) offer a balance between proper folding and yield.

Methodologically, expression optimization requires systematic testing of:

  • Induction conditions (temperature, duration, inducer concentration)

  • Cell lysis protocols (detergent selection for membrane protein extraction)

  • Purification strategies (affinity tags position and type)

Each system presents trade-offs between yield, cost, and authenticity of protein structure that must be evaluated through quantitative assessment of expression levels and functional activity.

How can I design experiments to investigate SSR3 interactions with other TRAP complex components in Pongo abelii?

Designing experiments to investigate protein-protein interactions between SSR3 and other TRAP complex components requires a systematic approach incorporating multiple complementary methods:

Experimental Design Recommendations:

  • Begin with co-immunoprecipitation (Co-IP) studies using antibodies specific to Pongo abelii SSR3 or tagged recombinant versions

  • Implement a randomized block design to control for variation across different tissue samples or expression conditions

  • Include appropriate controls in each experimental block to minimize batch effects

  • Apply crosslinking approaches (formaldehyde or DSS) to capture transient interactions

The experimental design should follow a hierarchical approach where:

  • Factors include protein variants, tissue sources, and experimental conditions

  • Blocks control for batch effects and technical variation

  • Replication ensures statistical power for detecting interaction effects

This design aligns with established principles of experimental design where "the designing of the experiment and the analysis of obtained data are inseparable" . Statistical analysis should employ ANOVA to evaluate the significance of observed interactions, with particular attention to interaction effects between factors.

What quantitative methods can resolve contradictory data in SSR3 functional studies?

When faced with contradictory results in SSR3 functional studies, implement these methodological approaches:

  • Meta-analytical approach:

    • Systematically catalog all experimental variables across contradictory studies

    • Quantify effect sizes using standardized metrics (Cohen's d or Hedges' g)

    • Apply random-effects models to account for between-study heterogeneity

  • Mixed methods investigation:

    • Combine quantitative assays with qualitative investigation of cellular mechanisms

    • Implement factorial experimental designs to identify interaction effects between variables

    • Control for covariates through ANCOVA when analyzing disparate datasets

  • Reconciliation through experimental design:

    ApproachApplication to SSR3 ResearchMethodological Advantage
    Latin Square DesignTest multiple variables (temperature, pH, cell type) simultaneouslyControls for multiple sources of variation
    Randomized BlockTest SSR3 variants across different cellular backgroundsReduces effects of biological variation between blocks
    Sequential TestingTest hypotheses about SSR3 function in hierarchical orderMinimizes false discovery rate in complex datasets

This structured approach ensures that apparent contradictions are systematically investigated rather than attributed to experimental error or biological variation alone .

How should computational modeling of Pongo abelii SSR3 structure be validated experimentally?

Robust validation of computational models for Pongo abelii SSR3 structure requires a multi-modal approach:

  • Primary Structure Validation:

    • Confirm sequence through mass spectrometry (MS/MS)

    • Validate post-translational modifications through enrichment and targeted MS

  • Secondary/Tertiary Structure Validation:

    • Circular dichroism (CD) spectroscopy to verify secondary structure elements

    • Limited proteolysis to identify exposed regions and domain boundaries

    • Cross-linking mass spectrometry (XL-MS) to validate predicted proximity relationships

  • Functional Validation:

    • Site-directed mutagenesis of predicted functional residues

    • Activity assays measuring protein translocation efficiency

    • Interaction studies with predicted binding partners

The experimental design should follow a systematic workflow where computational predictions generate specific hypotheses that are then tested experimentally. This approach exemplifies mixed-method research by combining "count-able data" from quantitative assays with qualitative structural insights .

What statistical approaches best analyze SSR3 expression data across different orangutan populations?

When analyzing SSR3 expression across orangutan populations, implement these statistical approaches:

  • Hierarchical linear modeling:

    • Account for nested data structures (individuals within social groups within populations)

    • Include random effects for maternal lineage when analyzing expression in related individuals

  • Covariate analysis:

    • Control for ecological factors such as fruit availability index (FAI) that might affect metabolic processes

    • Include association size and social factors as potential modulators of gene expression

  • Multivariate analysis:

    • Implement principal component analysis to identify patterns across multiple gene expression markers

    • Use discriminant analysis to identify expression signatures specific to different populations

This approach acknowledges the complex socioecological factors that can influence physiological processes in Pongo abelii, similar to how maternal behavior is modulated by socioecological factors .

How can I determine if observed SSR3 sequence variations in Pongo abelii represent functional adaptations?

To determine whether SSR3 sequence variations represent functional adaptations, implement this analytical framework:

  • Sequence Analysis:

    • Calculate conservation indices across primate lineages

    • Identify non-synonymous substitutions specific to Pongo abelii

    • Apply selection pressure analyses (dN/dS ratios) to identify positively selected sites

  • Structure-Function Correlation:

    • Map variations to structural models to identify potential functional impacts

    • Classify variants based on predicted effect on protein stability or interaction interfaces

  • Experimental Validation:

    Experimental ApproachData GeneratedInterpretation Framework
    Site-directed mutagenesisQuantitative activity measurementsCompare effect sizes between ancestral and derived states
    Heterologous expressionCellular localization patternsAssess changes in subcellular targeting
    Comparative biochemistryBinding affinity and kineticsEvaluate functional trade-offs in derived variants

This comprehensive approach integrates quantitative experimental data with evolutionary analysis to distinguish between neutral variation and adaptive change, representing a mixed-method research strategy that combines discovery and descriptive elements .

What are the best practices for normalizing qPCR data when studying SSR3 expression in different orangutan tissues?

When normalizing qPCR data for SSR3 expression across orangutan tissues, implement these methodological best practices:

  • Reference Gene Selection:

    • Systematically evaluate stability of candidate reference genes using geNorm, NormFinder, and BestKeeper algorithms

    • Select a minimum of three reference genes with demonstrated stability across the tissues under investigation

    • Validate reference gene stability under experimental conditions (e.g., developmental stages, disease states)

  • Normalization Strategy:

    • Apply geometric averaging of multiple reference genes rather than relying on a single gene

    • Calculate normalization factors using the ΔΔCt method with efficiency correction

    • Implement randomized block design in qPCR plate layout to control for technical variation

  • Statistical Analysis:

    • Apply appropriate transformation (log) to achieve normality when necessary

    • Implement mixed-effects models when analyzing longitudinal expression data

    • Control for biological covariates such as sex, age, and food availability index (FAI)

This approach ensures that observed expression differences represent biological reality rather than technical artifacts, aligning with principles of robust experimental design where "the designing of the experiment and the analysis of obtained data are inseparable" .

How can cryo-EM be optimized for structural studies of recombinant Pongo abelii SSR3 in membrane environments?

Optimizing cryo-EM for structural studies of membrane-embedded SSR3 requires addressing several technical challenges:

  • Sample Preparation:

    • Evaluate detergent-based versus nanodisc or amphipol reconstitution systems

    • Optimize grid preparation parameters (blotting time, humidity, temperature)

    • Implement gradient fixation (GraFix) to stabilize protein complexes

  • Data Collection Strategy:

    • Utilize dose fractionation with motion correction to minimize radiation damage

    • Implement tilt series collection to address preferred orientation issues

    • Apply energy filters to enhance contrast of the membrane-embedded regions

  • Computational Processing:

    • Implement 3D classification to identify conformational heterogeneity

    • Apply CTF correction strategies optimized for membrane proteins

    • Utilize focused refinement approaches for flexible domains

This methodological approach addresses the specific challenges of membrane protein structural biology through a systematic experimental design that controls for multiple sources of variation, exemplifying the principles of robust experimental design where "the basic terminology used in the experimental design" guides the implementation .

What experimental controls are essential when investigating post-translational modifications of SSR3 using mass spectrometry?

When investigating post-translational modifications (PTMs) of SSR3 using mass spectrometry, implement these essential experimental controls:

  • Negative Controls:

    • Analyze samples from SSR3 knockout/knockdown systems

    • Process recombinant protein expressed in systems lacking specific PTM machinery

    • Include mock enrichment samples to identify non-specific binding artifacts

  • Positive Controls:

    • Spike in synthetic peptides with known modifications at defined concentrations

    • Include recombinant protein with enzymatically introduced modifications

    • Process samples from conditions known to enhance specific modifications

  • Methodology Controls:

    Control TypeImplementationPurpose
    Technical replicatesRepeated processing of same biological sampleQuantify technical variation
    Randomized block designProcess samples in controlled batchesMinimize batch effects
    Orthogonal validationConfirm key findings with antibody-based methodsCross-validate MS findings

This systematic approach ensures reliable identification of biologically relevant PTMs while controlling for technical artifacts, representing a quantitative research methodology that generates "precise measurements with specific data variables" .

What emerging technologies will likely advance our understanding of SSR3 function in orangutans?

Several emerging technologies show promise for advancing our understanding of SSR3 function in Pongo abelii:

  • Single-cell transcriptomics:

    • Reveals cell-type specific expression patterns

    • Identifies co-expression networks at single-cell resolution

    • Enables developmental trajectory mapping of SSR3 expression

  • CRISPR-based functional genomics:

    • Facilitates precise genetic modification in relevant cell lines

    • Enables high-throughput screening of functional domains

    • Allows creation of isogenic lines for controlled comparison

  • Spatial transcriptomics:

    • Maps SSR3 expression within tissue architectural context

    • Reveals spatial relationships between expressing and interacting cells

    • Correlates expression with tissue-specific functions

These technologies will enable researchers to move beyond descriptive studies to mechanistic understanding, representing a shift toward mixed-method approaches that combine qualitative investigation of biological mechanisms with quantitative assessment of expression and function .

How should researchers approach the integration of SSR3 studies with broader orangutan conservation efforts?

Integrating SSR3 research with orangutan conservation requires thoughtful methodological approaches:

  • Ethical sample collection:

    • Prioritize non-invasive sampling methods

    • Integrate research with existing health monitoring programs

    • Develop protocols for sample sharing to maximize scientific output

  • Population-level studies:

    • Design sampling strategies using randomized block designs to ensure representation across populations

    • Apply power analysis to determine minimum sample sizes while minimizing impact

    • Control for socioecological factors such as habitat fragmentation, fruit availability (FAI), and social group dynamics

  • Knowledge translation:

    • Develop frameworks for communicating molecular findings to conservation stakeholders

    • Identify potential biomarkers of population health or stress that can inform conservation

    • Create standardized protocols for sample collection by field researchers

This approach exemplifies mixed-method research by combining "the number of times a specific behaviour is observed, under what conditions" , linking molecular mechanisms to observable conservation-relevant outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.