Recombinant Pongo abelii Transmembrane 4 L6 family member 1 (TM4SF1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo Abelii TM4SF1

Recombinant Pongo Abelii Transmembrane 4 L6 Family Member 1 (TM4SF1) is a His-tagged, full-length protein derived from the Sumatran orangutan (Pongo abelii). It belongs to the tetraspanin family, characterized by four transmembrane domains and extracellular regions critical for cell signaling and membrane organization. This recombinant protein is expressed in E. coli and purified for research applications, particularly in cancer biology and signaling pathway studies .

Protein Structure

TM4SF1 consists of:

  • Four transmembrane domains (TM1–4)

  • N-terminal and C-terminal intracellular domains

  • Two extracellular domains:

    • EC1 (small domain between TM1–2)

    • EC2 (large domain between TM3–4 with a three-α-loop structure)

Key Features of the Recombinant Protein

ParameterDetail
SourcePongo abelii (Sumatran orangutan)
Expression HostE. coli
TagN-terminal His-tag
LengthFull-length (1–202 amino acids)
Purity>90% (SDS-PAGE)
StorageLyophilized powder; store at -20°C/-80°C
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol added

Amino Acid Sequence (Partial):
MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETRYASENHLSRFVWFFSGIVGGGLLM...

Biological Functions

TM4SF1 regulates:

  1. Cell migration and invasion via epithelial-mesenchymal transition (EMT) .

  2. Cancer stemness through Wnt/β-catenin signaling and SOX2 expression .

  3. Drug resistance by modulating PI3K/AKT/mTOR and apoptosis pathways .

Key Interactions

Partner ProteinInteraction Role
DDR1Forms complexes to activate JAK2-STAT3, promoting metastasis .
Syntenin-2Binds via PDZ-domain motif, enhancing cell proliferation .
MMP2/9Regulates invadopodia formation and extracellular matrix degradation .

Cancer-Specific Roles

Cancer TypeTM4SF1 MechanismImpact on Prognosis
PancreaticPromotes invadopodia formation via DDR1/MMP2-9 axis .Poor survival
BladderInduces ROS metabolism and cell cycle arrest via PPARγ-SIRT1 pathways .High-grade progression
ColorectalActivates Wnt/β-catenin/c-Myc/SOX2 axis, enhancing cancer stemness .Metastasis and recurrence

Experimental Evidence

  • Silencing TM4SF1 reduces:

    • Cell migration (e.g., SW480 and LoVo colorectal cells) .

    • Drug resistance (e.g., gemcitabine sensitivity in pancreatic cancer) .

  • Overexpression increases:

    • Tumorsphere formation in colorectal cancer .

    • Expression of EMT markers (vimentin, N-cadherin) .

Therapeutic Implications

  • Targeting TM4SF1-DDR1 interaction: Antibody drugs to disrupt metastasis .

  • JAK2 kinase inhibitors: Potential for blocking STAT3-mediated oncogenesis .

  • Wnt/β-catenin inhibitors: Reducing cancer stemness in colorectal cancer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development according to your request.
Synonyms
TM4SF1; Transmembrane 4 L6 family member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETRYASENHLSRFVWFFSGIVGGGLLM LLPAFVLIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPL CLDSLGQWNYTFASTEGQYLLDTSTWSQCTEPKHIVEWNVSLFSILLALGGIEFILCLIQ VINGVLGGICGFCCSRQQQYDC
Uniprot No.

Target Background

Database Links
Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TM4SF1 and what distinguishes it from other transmembrane protein families?

TM4SF1 (Transmembrane-4-L-six-family-1), also known as L6 or TAL6, belongs to the L6 superfamily rather than the broader TM4SF protein family. Unlike typical TM4SF members, TM4SF1 lacks the highly conserved CCG (Cys-Cys-Gly) sequence despite sharing similar topology . The protein consists of 202 amino acids in Pongo abelii (orangutan), with four transmembrane domains and characteristic extracellular loops . Other members of the L6 superfamily include TM4SF4, TM4SF5, TM4SF18, TM4SF19, and TM4SF20 .

For experimental investigations, researchers should note that the protein's transmembrane nature requires careful handling during reconstitution. The recommended approach involves brief centrifugation before opening, reconstitution in deionized sterile water to 0.1-1.0 mg/mL, and adding 5-50% glycerol for long-term storage, with aliquoting to avoid repeated freeze-thaw cycles .

How is TM4SF1 expression regulated in normal versus cancer tissues?

Immunohistochemistry studies across 16 different cancer types have demonstrated that TM4SF1 is highly expressed on cancer cell membranes but exhibits undetectable expression in adjacent normal tissues . This differential expression pattern makes TM4SF1 a potential biomarker for cancer diagnosis and therapeutic targeting.

When investigating TM4SF1 expression:

  • Use immunohistochemistry with paired cancer and normal tissue samples

  • Validate results using multiple antibodies to ensure specificity

  • Quantify membrane localization specifically, as opposed to cytoplasmic staining

  • Correlate with matched transcriptomic data when available to assess concordance between protein and mRNA levels

What is the relationship between TM4SF1 and cancer stem cells (CSCs)?

TM4SF1 functions as a cell membrane marker of cancer stem cells. Research has demonstrated higher proportions of CD44high/CD24low cells (established CSC markers) among TM4SF1high populations in MDA-MB-231 human breast cancer cells compared to TM4SF1low populations . TM4SF1high cells from multiple cancer cell lines, including breast cancer (MDA-MB-231, MDA-MB-453), melanoma (A375, A2058), and lung cancer (H460, H2030, H1975), consistently demonstrate enhanced tumor sphere formation capability during serial passage .

At the molecular level, TM4SF1 sustains CSC traits by promoting pluripotency factor expression, with notable upregulation of SOX2 and NANOG observed in TM4SF1high cancer cells .

How does TM4SF1 contribute to cancer progression via signaling pathway modulation?

TM4SF1 activates multiple signaling cascades that promote cancer progression:

  • DDR1-JAK2-STAT3 Pathway: TM4SF1 couples with discoidin domain receptor tyrosine kinase 1 (DDR1) under collagen I stimulation, leading to JAK2-STAT3 signaling activation. This noncanonical DDR1 signaling pathway drives the expression of pluripotency genes SOX2 and NANOG, maintaining CSC traits and promoting multiorgan metastases .

  • Wnt/β-catenin Pathway: TM4SF1 promotes epithelial-to-mesenchymal transition (EMT) and cancer stemness through the Wnt/β-catenin signaling pathway, particularly in colorectal cancer .

For investigating these pathways, researchers should employ:

  • Co-immunoprecipitation to detect protein-protein interactions between TM4SF1 and DDR1

  • Phospho-specific antibodies to monitor JAK2-STAT3 activation status

  • Reporter assays (TOPFlash/FOPFlash) to measure Wnt/β-catenin pathway activity

  • Genetic manipulation (knockdown/overexpression) followed by pathway component assessment

  • 3D culture systems with collagen I to recapitulate the extracellular matrix environment

What methodologies are recommended for studying TM4SF1's role in epithelial-to-mesenchymal transition?

EMT is a critical process in cancer progression that TM4SF1 appears to regulate. To investigate this:

  • Cell Model Selection: Choose cell lines with well-characterized epithelial/mesenchymal phenotypes (e.g., colorectal cancer lines)

  • Morphological Assessment: Monitor changes in cell morphology using phase-contrast microscopy

  • Marker Evaluation: Assess epithelial markers (E-cadherin, ZO-1) and mesenchymal markers (N-cadherin, Vimentin, Fibronectin) via immunoblotting and immunofluorescence

  • Functional Assays:

    • Transwell migration and invasion assays

    • Wound healing assays to assess collective cell migration

    • 3D culture systems to evaluate invasive phenotypes

  • Signaling Pathway Analysis: Investigate Wnt/β-catenin pathway components (active β-catenin, GSK3β phosphorylation)

  • Transcription Factor Assessment: Measure EMT-related transcription factors (SNAI1, SNAI2, ZEB1, ZEB2, TWIST1)

How can researchers effectively use recombinant TM4SF1 proteins in experimental studies?

When working with recombinant TM4SF1:

  • Protein Selection: Choose between full-length and domain-specific constructs based on your experimental question

  • Expression System Considerations:

    • E. coli-expressed TM4SF1 (like the Pongo abelii recombinant) lacks post-translational modifications

    • For studies requiring glycosylation or other modifications, consider mammalian or insect cell expression systems

  • Reconstitution Protocol:

    • Centrifuge vials briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

  • Application-Specific Considerations:

    • For antibody generation: Use purified recombinant protein for immunization

    • For binding studies: Consider tag position effects on protein function

    • For functional studies: Compare with native protein from cellular sources

What are current approaches for developing TM4SF1-targeted cancer therapies?

TM4SF1 presents an attractive target for cancer therapy development:

  • Monoclonal Antibody Approach:

    • Target the functional extracellular domains of TM4SF1

    • Assess antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC)

    • Evaluate antibody-drug conjugate (ADC) potential

  • CAR-T Cell Development:

    • TM4SF1-CAR-T cells have demonstrated specific cytotoxicity against TM4SF1-positive tumor cells in vitro

    • These engineered cells release IFN-γ and TNF-α upon target recognition

    • In vivo studies have shown significant inhibition of tumor growth with 90% remission rates in SKOV3-derived tumor models

  • Signaling Pathway Intervention:

    • Target downstream effectors of TM4SF1 signaling (JAK2, STAT3)

    • Develop small molecule inhibitors of TM4SF1-DDR1 interaction

  • Methodology for Assessment:

    • Cytotoxicity assays (MTT, LDH release)

    • Flow cytometry for target binding and immune cell activation

    • Cytokine release measurements

    • Animal models with established tumors expressing TM4SF1

How can TM4SF1 expression be utilized in cancer prognosis models?

TM4SF1 has significant prognostic implications across multiple cancer types:

  • Pancreatic Adenocarcinoma (PAAD):

    • TM4SF1 is significantly upregulated in PAAD compared to normal tissues

    • Lower TM4SF1 expression correlates with enhanced anti-tumor immunity

    • A prognostic model incorporating TM4SF1 and related genes (BPIFB4, PLEKHN1, CPTP, DVL1, and DDR1) has demonstrated robust associations with patient survival outcomes

  • Multi-cancer Prognostic Analysis:

    • Methodological approach:

      • Utilize multivariate Cox regression analysis

      • Apply least absolute shrinkage and selection operator (LASSO) regression for feature selection

      • Validate across independent patient cohorts

      • Correlate with immune infiltration metrics

  • Integration with Other Biomarkers:

    • Combine TM4SF1 expression with established prognostic markers

    • Develop composite scores for improved predictive power

    • Correlate with treatment response data where available

What methodologies are recommended for investigating evolutionary conservation of TM4SF1 function?

Understanding evolutionary conservation can provide insights into fundamental TM4SF1 functions:

  • Sequence Analysis:

    • Compare TM4SF1 sequences across species (human, non-human primates like Pongo abelii, rodents)

    • Identify conserved domains, particularly within transmembrane regions and functional loops

    • Analyze conservation of interaction motifs with binding partners (e.g., DDR1)

  • Functional Conservation Assessment:

    • Express TM4SF1 from different species in model cell systems

    • Compare ability to activate downstream signaling pathways

    • Assess complementation in TM4SF1-knockout backgrounds

  • Structural Biology Approaches:

    • Generate homology models based on available structural data

    • Predict conservation of critical binding interfaces

    • Use comparative modeling to identify species-specific differences

  • Experimental Design Table for Cross-Species TM4SF1 Functional Analysis:

Species SourceExpression SystemFunctional AssaysExpected OutcomesPotential Challenges
HumanMammalian cellsCSC marker expression, sphere formationBenchmark for comparisonBackground expression
Pongo abeliiE. coli , mammalian cellsComparative signaling activationSimilar to human if conservedPost-translational modifications
MouseMammalian cellsIn vivo tumor modelsMay show species-specific differencesCross-reactivity with antibodies
ZebrafishTransgenic expressionDevelopmental effectsInsight into fundamental rolesSystem optimization

What are the challenges and considerations in developing TM4SF1-CAR-T cell therapies?

TM4SF1-CAR-T cell therapy shows promise but faces specific challenges:

  • Target Selection Considerations:

    • TM4SF1-CAR-T cells have demonstrated specific cytotoxicity against TM4SF1-positive tumor cells

    • They produce IFN-γ and TNF-α and have shown 90% remission rates in xenograft models

    • Despite minimal TM4SF1 expression in normal tissues, comprehensive safety screening is essential

  • Methodological Approaches:

    • Optimize CAR design (scFv selection, hinge region, co-stimulatory domains)

    • Develop robust manufacturing processes with quality controls

    • Test against patient-derived xenografts for various cancer types

    • Implement safety switches (suicide genes) to mitigate potential toxicity

  • Combination Strategy Development:

    • Test TM4SF1-CAR-T cells with checkpoint inhibitors

    • Evaluate dual-targeting approaches to reduce escape mechanisms

    • Consider combination with conventional therapies

What techniques are recommended for analyzing TM4SF1's protein-protein interactions?

Investigating TM4SF1 interactome requires specialized approaches for membrane proteins:

  • Co-immunoprecipitation (Co-IP):

    • Use mild detergents (CHAPS, digitonin) to preserve membrane protein interactions

    • Consider crosslinking to stabilize transient interactions

    • Validate with reverse Co-IP (pull down interaction partner)

  • Proximity Labeling Methods:

    • BioID or TurboID fusion proteins to identify proximal proteins

    • APEX2-based proximity labeling in intact cells

    • MS-based identification of labeled proteins

  • Fluorescence-based Techniques:

    • Förster resonance energy transfer (FRET) for direct interactions

    • Bimolecular fluorescence complementation (BiFC) for protein complex visualization

    • Fluorescence correlation spectroscopy (FCS) for dynamic interactions

  • Specific TM4SF1 Interactions to Investigate:

    • TM4SF1-DDR1 interaction under collagen I stimulation

    • Association with components of the Wnt/β-catenin pathway

    • Potential interactions with other membrane proteins in tetraspanin-enriched microdomains

How can researchers effectively modulate TM4SF1 expression in experimental models?

For mechanistic studies, precise control of TM4SF1 expression is crucial:

  • Gene Silencing Approaches:

    • siRNA for transient knockdown (optimize transfection for membrane protein)

    • shRNA for stable knockdown (validate multiple constructs)

    • CRISPR-Cas9 for complete knockout (screen multiple sgRNAs)

  • Overexpression Systems:

    • Inducible expression systems (Tet-On/Off) for temporal control

    • Viral vectors for efficient delivery to diverse cell types

    • Tagged constructs for tracking expression and localization

  • Domain-specific Manipulation:

    • Generate truncation mutants to identify functional domains

    • Create point mutations in conserved residues

    • Express dominant-negative forms to disrupt specific interactions

  • In vivo Modulation:

    • Develop conditional knockout mouse models

    • Use AAV-mediated delivery for tissue-specific modulation

    • Employ xenograft models with manipulated cell lines

How does TM4SF1 expression correlate with immune infiltration in the tumor microenvironment?

Recent findings suggest TM4SF1 may influence anti-tumor immunity:

  • Correlation Analysis Approach:

    • Compare TM4SF1 expression with immune cell signature genes

    • Use single-cell RNA sequencing to identify cell-specific relationships

    • Analyze spatial relationships using multiplexed immunohistochemistry

  • Functional Investigation:

    • Assess T cell activation and function in the presence of TM4SF1-expressing cells

    • Evaluate NK cell recognition of TM4SF1high versus TM4SF1low cancer cells

    • Investigate dendritic cell interaction with cancer cells based on TM4SF1 expression

  • Clinical Correlation:

    • Analyze response to immunotherapy based on TM4SF1 expression levels

    • Develop combination approaches targeting TM4SF1 plus immune checkpoints

The research in pancreatic adenocarcinoma indicates that lower TM4SF1 expression correlates with enhanced anti-tumor immunity , suggesting complex relationships between this protein and immune surveillance mechanisms.

What is known about TM4SF1's role across different cancer types and how should comparative studies be designed?

TM4SF1 has been implicated in multiple cancer types with potentially distinct functions:

  • Pan-cancer Analysis Strategy:

    • Compare expression levels across The Cancer Genome Atlas (TCGA) datasets

    • Correlate with cancer-specific survival outcomes

    • Identify cancer types with highest therapeutic potential

  • Cancer-specific Functions:

    • Pancreatic adenocarcinoma: Prognostic marker associated with immune response

    • Colorectal cancer: Promotes EMT and cancer stemness via Wnt/β-catenin pathway

    • Breast cancer: Maintains cancer stem cell traits

  • Experimental Design for Comparative Studies:

    • Use matched cell line panels across cancer types

    • Employ consistent functional assays for cross-comparison

    • Develop tissue-specific in vivo models

  • Translational Implications:

    • Identify cancer types most likely to benefit from TM4SF1-targeted therapy

    • Develop biomarker strategies for patient selection

    • Design cancer-specific combination approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.