Recombinant Pongo abelii Transmembrane 4 L6 family member 4 (TM4SF4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pongo abelii TM4SF4

Recombinant TM4SF4 is a full-length, His-tagged protein derived from the Sumatran orangutan (Pongo abelii), expressed in E. coli . Key characteristics include:

PropertySpecification
UniProt IDQ5R6Z4
Protein Length202 amino acids (1–202aa)
TagN-terminal His tag
Molecular Weight (Unglycosylated)~21 kDa
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability

Functional Interactions

  • Thiamine Transport: Binds to human thiamine transporter-2 (hTHTR-2), enhancing cellular thiamine uptake by 2–3 fold in intestinal cells .

  • Oncogenic Role: Overexpression correlates with lymph node metastasis in papillary thyroid carcinoma (OR = 1.786, p = 0.006) .

Research Applications

Recombinant TM4SF4 is utilized in:

  • ELISA Development: Commercial kits for protein quantification (e.g., CSB-CF719151PYX) .

  • Antibody Production: Used to validate anti-TM4SF4 antibodies (e.g., FAB7998A for flow cytometry) .

  • Mechanistic Studies: Investigates roles in intestinal epithelial cell density-dependent proliferation and hepatocellular carcinoma progression .

Clinical and Diagnostic Relevance

FindingSource
Overexpression in hepatocellular carcinomas and periportal hepatocytes R&D Systems
Independent predictor of lymph node metastasis in thyroid cancer PMC Study
Association with IGF1/IGF1R activation in lung adenocarcinoma MyBioSource

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
TM4SF4; Transmembrane 4 L6 family member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TM4SF4
Target Protein Sequence
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMI FPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKC LMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVN GLLGTLCGDCQCCGCCGGDGPV
Uniprot No.

Target Background

Function
This protein regulates the adhesive and proliferative properties of intestinal epithelial cells. It can also mediate density-dependent cell proliferation.
Database Links
Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and cellular localization of TM4SF4?

TM4SF4 belongs to the tetraspanin superfamily comprising approximately 33 proteins localized in the plasma membrane. Each protein in this family consists of four transmembrane domains, short intracellular amino and carboxy tails, a small intracellular loop, and two extracellular loops . The protein sequence of Pongo abelii TM4SF4 includes 202 amino acids with specific functional domains that facilitate its interaction with other membrane proteins .

In normal human tissues, TM4SF4 exhibits a restricted expression profile primarily in the gastrointestinal tract and pancreas . Interestingly, immunohistochemistry studies have revealed that TM4SF4 protein is specifically localized on the bile duct canaliculi of normal liver tissues, whereas in hepatocellular carcinoma, it is expressed on all sides of the plasma membrane domains . This differential localization pattern suggests functional adaptation in the cancer microenvironment.

What biological functions is TM4SF4 associated with in normal tissues?

In normal tissues, TM4SF4 appears to be involved in several fundamental cellular processes. Gene Ontology (GO) enrichment analysis of genes highly correlated with TM4SF4 expression in non-tumor liver tissues identified five significant functional groups: plasma membrane components, cellular adhesion, myosin complexes, and secretory vesicles .

Tetraspanins generally exert diverse biological functions including cell adhesion, motility, invasion, and signal transduction through their unique abilities to associate with other proteins . TM4SF4 specifically contributes to maintaining normal cellular architecture and function through these interaction networks. The protein's restricted expression pattern in normal tissues suggests tissue-specific functions that are important for maintaining homeostasis in organs such as the gastrointestinal tract and pancreas.

How does TM4SF4 expression differ between normal tissues and cancer tissues?

Multiple studies have demonstrated significant differential expression of TM4SF4 between normal and cancerous tissues. In papillary thyroid cancer, TM4SF4 is significantly upregulated compared to normal thyroid tissues, as confirmed by both TCGA data and independent cohorts (GSE33630, GSE60542, and GSE129562) .

Similarly, in hepatocellular carcinoma, TM4SF4 protein expression is significantly higher in cancer tissues compared to paired non-cancerous liver tissues . Comparative analyses across multiple datasets (TCGA, GSE14520, CNHPP, and CHCC) have shown that TM4SF4 expression is significantly higher than several other potential HCC therapeutic targets (CD24, CD133, CD147, EPCAM, GPC3, MET, and MUC1) . This differential expression profile makes TM4SF4 a promising diagnostic biomarker and therapeutic target.

What are the optimal protocols for expressing and purifying recombinant TM4SF4 protein?

  • Codon optimization for the expression host is essential to enhance protein yield

  • Induction conditions should be carefully optimized (temperature, IPTG concentration, induction time)

  • Membrane protein solubilization requires appropriate detergents

  • Purification typically involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

For maintaining protein stability during storage, a Tris-based buffer with 50% glycerol has proven effective . Long-term storage should be at -20°C or -80°C, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles that could compromise protein integrity .

What experimental approaches are most effective for studying TM4SF4's role in cancer progression?

Based on current research, several experimental approaches have proven valuable for investigating TM4SF4's role in cancer progression:

  • Gene knockdown/knockout studies: RNA interference (siRNA, shRNA) and CRISPR-Cas9 technologies have successfully demonstrated that TM4SF4 downregulation suppresses proliferation and metastasis of cancer cell lines while inducing apoptosis . These techniques provide direct evidence of TM4SF4's oncogenic functions.

  • Signaling pathway analysis: Pharmacological intervention using pathway-specific activators/inhibitors has revealed mechanistic insights. For instance, the AKT activator SC79 was able to reverse the malignant behavior suppression caused by TM4SF4 knockdown, suggesting that TM4SF4 promotes cancer progression via the AKT pathway .

  • Multi-omics approaches: Integration of transcriptomics, proteomics, and single-cell RNA sequencing data has successfully identified TM4SF4-associated gene networks and biological processes . This approach revealed that TM4SF4 expression in HCC is associated with mitochondrial components and oxidative phosphorylation.

  • Animal models: Xenograft models using TM4SF4-manipulated cancer cell lines have demonstrated that TM4SF4 knockdown represses tumor growth in vivo , providing translational relevance to in vitro findings.

How can researchers effectively measure and validate TM4SF4 expression in tissue samples?

Multiple complementary approaches should be employed to accurately measure and validate TM4SF4 expression:

  • Transcriptomic analysis: RT-qPCR remains the gold standard for mRNA quantification, while RNA-seq provides broader context through global expression profiling . Several validated primer sets have been documented in the literature for specific and sensitive detection of TM4SF4 transcripts.

  • Protein detection:

    • Western blotting using validated antibodies (like anti-TM4SF4 rabbit polyclonal antibody HPA046430)

    • Immunohistochemistry (IHC) with careful attention to membrane localization patterns

    • ELISA for quantitative measurement in tissue lysates

  • Validation across multiple cohorts: To ensure reproducibility, findings should be validated across independent patient cohorts, as demonstrated in studies that confirmed TM4SF4 upregulation in PTC across TCGA data and local cohorts .

  • Correlation with clinical parameters: Receiver operating characteristic (ROC) curve analysis can evaluate TM4SF4's diagnostic value, while association studies with clinicopathological features (tumor size, lymph node metastasis, etc.) can establish clinical relevance .

What is the diagnostic value of TM4SF4 expression in cancer?

The diagnostic value of TM4SF4 has been extensively evaluated in papillary thyroid cancer (PTC). Clinical characteristics analysis and receiver operating characteristic curves (ROC) have demonstrated that TM4SF4 serves as a significant diagnostic marker for PTC . In the TCGA cohort, high TM4SF4 expression was significantly correlated with classical PTC type .

For hepatocellular carcinoma (HCC), TM4SF4 shows promising diagnostic potential due to its restricted expression in normal tissues but high expression in HCC cases . Comparative analyses have shown that TM4SF4 has a more favorable expression profile for diagnostic purposes than several other common HCC markers.

Importantly, multivariate logistic regression analysis has identified TM4SF4 expression as an independent prediction factor for lymph node metastasis (LNM) in PTC patients (OR = 1.786, 95% CI: 1.181–2.700, p = .006) . This suggests that TM4SF4 could serve not only as a diagnostic marker but also as a predictor of disease progression and metastatic potential.

How does TM4SF4 expression correlate with immune infiltration in cancer microenvironments?

Immune infiltration analysis has revealed a positive correlation between TM4SF4 expression and immune activation in papillary thyroid cancer . This relationship suggests that TM4SF4 may influence the tumor microenvironment by modulating immune cell recruitment or function.

While specific mechanisms remain to be fully elucidated, this correlation raises important questions about the potential immunomodulatory effects of TM4SF4. Researchers investigating this relationship should consider:

  • Flow cytometry analysis of tumor-infiltrating lymphocytes in relation to TM4SF4 expression

  • Single-cell RNA sequencing to characterize immune cell populations in TM4SF4-high versus TM4SF4-low tumors

  • Functional assays to determine if TM4SF4 directly affects immune cell function or recruitment

  • Evaluation of immunotherapy response rates in patients with varying levels of TM4SF4 expression

What are the challenges and considerations in developing TM4SF4-targeted therapies?

Developing effective TM4SF4-targeted therapies faces several challenges that researchers must address:

  • Target specificity: Despite TM4SF4 having a more restricted expression profile than other potential targets, it is still expressed in normal tissues, particularly in the gastrointestinal tract and pancreas . Therapeutic approaches must minimize off-target effects on these tissues.

  • Antibody development: Given that TM4SF4 is a transmembrane protein with two extracellular loops, antibody-based therapies should target accessible epitopes. The structural complexity of these domains may present challenges for antibody binding specificity and affinity.

  • Functional redundancy: As a member of the tetraspanin superfamily, functional redundancy with other family members may limit therapeutic efficacy. Understanding the unique functions of TM4SF4 versus other tetraspanins is crucial.

  • Resistance mechanisms: Cancer cells may develop resistance to TM4SF4-targeted therapies through compensatory signaling pathways. Studies suggest TM4SF4 promotes cancer progression via the AKT pathway , indicating potential for combination therapies targeting multiple nodes in this network.

  • Translation to other cancer types: While evidence supports TM4SF4 as a promising target in PTC and HCC, its role in other cancers requires investigation before broader therapeutic applications can be considered.

Through which signaling pathways does TM4SF4 exert its oncogenic effects?

Current evidence suggests that TM4SF4 primarily exerts its oncogenic effects through the AKT signaling pathway. In vitro experiments have demonstrated that the AKT activator SC79 was able to reverse the malignant behaviors suppression caused by TM4SF4 knockdown, strongly suggesting that TM4SF4 promotes cancer progression via the AKT pathway .

This pathway is known to regulate multiple cellular processes including proliferation, survival, metabolism, and migration—all hallmarks of cancer progression. The specific molecular interactions between TM4SF4 and components of the AKT pathway remain to be fully characterized, presenting an important area for future research.

Additionally, GO enrichment analysis of genes correlated with TM4SF4 expression in HCC cells revealed associations with mitochondrial components and energy production, as well as cellular detoxification, lipid processes, and nucleotide synthesis/metabolism . These findings suggest that TM4SF4 may also influence cancer metabolism and energy production, potentially through mitochondrial functions.

How does TM4SF4 interact with other proteins to influence cell behavior?

As a member of the tetraspanin superfamily, TM4SF4 likely forms protein complexes at the cell membrane through interactions with other membrane proteins. Correlation and enrichment analysis of TM4SF4-related partners suggested that it is involved in cell junction and cohesion processes .

In non-tumor liver tissues, TM4SF4 expression correlates with genes involved in plasma membrane components, cellular adhesion, myosin complexes, and secretory vesicles . This suggests that TM4SF4 may normally function in maintaining cellular architecture and intercellular communication.

In cancer cells, TM4SF4 expression correlates with a different set of genes. The top correlated genes identified in single-cell RNA sequencing data include CLU, SCP2, AGT, ALB, and SDHC . These associations suggest altered molecular interactions in the cancer context that may contribute to oncogenic processes.

To fully characterize these protein-protein interactions, researchers should consider:

  • Co-immunoprecipitation studies followed by mass spectrometry

  • Proximity ligation assays to visualize protein interactions in situ

  • FRET/BRET analyses for dynamic interaction studies

  • Yeast two-hybrid or mammalian two-hybrid screening to identify novel interaction partners

What are the key considerations when designing experiments to study TM4SF4 in different cancer models?

When designing experiments to study TM4SF4 across different cancer models, researchers should consider the following key factors:

  • Model selection: Different cancer types show varying levels of TM4SF4 expression and dependence. Evidence supports significant roles in PTC and HCC , but other cancer types should be evaluated systematically. Cell line selection should be guided by baseline TM4SF4 expression levels, which can be verified using publicly available databases such as Cancer Cell Line Encyclopedia (CCLE).

  • Expression validation: Before conducting functional studies, baseline TM4SF4 expression should be verified in selected models using both mRNA and protein detection methods to ensure the model is appropriate for the research question.

  • Genetic manipulation strategies:

    • For overexpression studies: consider inducible systems to control expression levels

    • For knockdown/knockout: compare transient versus stable approaches, and validate specificity with multiple siRNA/shRNA sequences or CRISPR guides

    • Include appropriate controls (empty vector, scrambled siRNA, etc.)

  • Functional assays: Select assays based on the specific aspect of cancer biology being studied (proliferation, invasion, metastasis, etc.) and include both in vitro and in vivo approaches when possible.

  • Downstream pathway analysis: Include analysis of the AKT pathway and other potential signaling networks, as evidence suggests TM4SF4 acts through these mechanisms .

What antibodies and detection methods are most reliable for TM4SF4 research?

Based on the available literature, several validated reagents and methods have been employed successfully in TM4SF4 research:

  • Antibodies for Western blotting and IHC:

    • Anti-TM4SF4 rabbit polyclonal antibody (HPA046430) has been validated by orthogonal methods and shows consistency with transcript expression data across human tissues

    • In-house developed polyclonal antibodies have also been successfully used in some studies

  • Recombinant protein standards:

    • Full-length recombinant TM4SF4 protein with N-terminal His-tag expressed in E. coli provides a reliable positive control for antibody validation and assay development

  • Detection methods:

    • For IHC: Standard protocols with attention to membrane localization patterns

    • For Western blotting: SDS-PAGE conditions optimized for membrane proteins

    • For flow cytometry: Surface staining protocols with careful antibody titration

  • Expression analysis:

    • RT-qPCR with validated primers

    • RNA-seq followed by appropriate bioinformatic analysis

    • Single-cell RNA sequencing to account for cellular heterogeneity

How can researchers address the challenges of studying transmembrane proteins like TM4SF4?

Studying transmembrane proteins presents unique challenges that researchers should address through specialized approaches:

  • Protein isolation and purification:

    • Use appropriate detergents (e.g., CHAPS, DDM, or Triton X-100) for membrane protein solubilization

    • Consider native membrane environments or nanodiscs for functional studies

    • Optimize purification protocols to maintain protein stability and native conformation

  • Structural studies:

    • Cryo-EM may be more suitable than X-ray crystallography for transmembrane proteins like TM4SF4

    • Molecular dynamics simulations can provide insights into membrane interactions

    • Consider hybrid approaches combining experimental data with computational modeling

  • Functional assays:

    • Membrane protein trafficking studies using fluorescent fusion proteins

    • Liposome reconstitution for isolated functional studies

    • Biolayer interferometry or surface plasmon resonance for interaction studies

  • Expression systems:

    • Mammalian expression systems may provide more native post-translational modifications than bacterial systems

    • Insect cell systems offer a compromise between yield and post-translational processing

    • Cell-free expression systems with appropriate lipid environments can be considered for difficult-to-express constructs

What are promising areas for future research on TM4SF4's role in cancer biology?

Several promising research directions could significantly advance our understanding of TM4SF4's role in cancer biology:

  • Mechanistic studies of the TM4SF4-AKT axis: Further characterization of how TM4SF4 activates or modulates the AKT pathway would provide valuable insights into its oncogenic mechanisms . Identifying the specific protein-protein interactions or signaling intermediates would be particularly valuable.

  • TM4SF4 in cancer metabolism: GO enrichment analysis suggests associations with mitochondrial components and energy production in HCC cells . Investigating how TM4SF4 influences cancer metabolism could reveal novel therapeutic vulnerabilities.

  • Immune microenvironment interactions: The positive correlation between TM4SF4 expression and immune activation in cancer warrants further investigation into potential immunomodulatory roles.

  • Biomarker development: Validating TM4SF4 as a diagnostic, prognostic, or predictive biomarker across larger patient cohorts and additional cancer types could enhance its clinical utility.

  • Cancer stem cell biology: Given the role of other tetraspanin family members in cancer stem cell maintenance, investigating potential connections between TM4SF4 and cancer stemness could yield important insights.

What therapeutic approaches targeting TM4SF4 show the most promise?

Based on current understanding of TM4SF4 biology, several therapeutic approaches warrant further investigation:

  • Monoclonal antibodies: Developing antibodies targeting the extracellular domains of TM4SF4 could enable specific targeting of cancer cells with high TM4SF4 expression. These could function through various mechanisms including antibody-dependent cellular cytotoxicity (ADCC) or antibody-drug conjugates (ADCs).

  • CAR T-cell therapy: The relatively restricted expression profile of TM4SF4 in normal tissues compared to its high expression in certain cancers makes it a promising target for CAR T-cell development . This approach could be particularly valuable for cancers with limited treatment options.

  • Small molecule inhibitors: Targeting the interaction between TM4SF4 and its binding partners or downstream effectors could disrupt oncogenic signaling. This approach would require further characterization of TM4SF4's protein interaction network.

  • Combination therapies: Given TM4SF4's connection to the AKT pathway , combining TM4SF4-targeted therapies with AKT inhibitors or other pathway-specific agents could enhance therapeutic efficacy and reduce resistance development.

  • RNA interference therapeutics: Advances in siRNA delivery technologies could enable direct targeting of TM4SF4 expression in cancer cells, potentially replicating the anti-tumor effects observed in preclinical knockdown studies .

What are the most significant findings about TM4SF4 in cancer research to date?

The most significant findings about TM4SF4 in cancer research include:

  • TM4SF4 is significantly upregulated in multiple cancer types, including papillary thyroid cancer and hepatocellular carcinoma, compared to corresponding normal tissues .

  • TM4SF4 serves as a significant diagnostic marker for cancer, with high sensitivity and specificity as demonstrated by ROC curve analysis .

  • TM4SF4 expression is an independent predictor for lymph node metastasis in PTC patients, indicating its potential as a prognostic biomarker .

  • Experimental evidence supports an oncogenic role for TM4SF4, as its knockdown suppresses cancer cell proliferation and metastasis while inducing apoptosis .

  • TM4SF4 appears to promote cancer progression via the AKT pathway, providing mechanistic insights into its oncogenic functions .

  • TM4SF4 has a more restricted expression profile in normal human tissues compared to other potential cancer therapeutic targets, making it a promising candidate for targeted therapy development .

  • TM4SF4 expression is associated with mitochondrial components and energy production in cancer cells, suggesting potential roles in cancer metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.