Recombinant Pongo abelii Transmembrane protein 111 (TMEM111)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance, incurring additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
EMC3; TMEM111; ER membrane protein complex subunit 3; Transmembrane protein 111
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-261
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
EMC3
Target Protein Sequence
AGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVL RENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPM ILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRS IYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEEL MAKDLHFEGMFKKELQTSIF
Uniprot No.

Target Background

Function
TMEM111 is a component of the endoplasmic reticulum membrane protein complex (EMC). It facilitates the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum membrane. It preferentially accommodates proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features like charged and aromatic residues. TMEM111 participates in the cotranslational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. It is also crucial for the post-translational insertion of tail-anchored (TA) proteins into the endoplasmic reticulum membrane. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology (with the translocated N-terminus in the ER lumen), it controls the topology of multi-pass membrane proteins such as G protein-coupled receptors. Through its regulation of protein membrane insertion, TMEM111 indirectly influences numerous cellular processes.
Database Links
Protein Families
EMC3 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is TMEM111 and what is its basic function in cellular systems?

TMEM111, also known as EMC3, is a subunit of the highly conserved ER membrane protein complex (EMC). This complex was first identified in Saccharomyces cerevisiae as a 6-subunit transmembrane protein complex required for protein folding in the endoplasmic reticulum (ER) . The protein plays a critical role in maintaining ER homeostasis by facilitating proper folding of membrane proteins. In Pongo abelii (Sumatran orangutan), TMEM111 functions as part of the cellular machinery responsible for protein quality control and membrane protein assembly .

How should researchers design experiments to study TMEM111 function in cellular systems?

When designing experiments to study TMEM111 function, researchers should consider a quasi-experimental approach that allows for causal inference while acknowledging practical limitations . For cellular studies, a nonequivalent groups design is often appropriate, where cells with normal TMEM111 expression are compared with those where TMEM111 has been knocked down or knocked out .

A systematic experimental design should include:

  • Defining variables: Clear identification of independent variables (e.g., TMEM111 expression levels) and dependent variables (e.g., ER stress markers, protein folding efficiency) .

  • Developing testable hypotheses: For example, "Reduced TMEM111 expression leads to increased accumulation of misfolded membrane proteins."

  • Appropriate controls: Include both positive controls (known inducers of ER stress) and negative controls (cells with normal TMEM111 function) .

  • Measurement protocol: Establish clear methods for quantifying outcomes, such as Western blotting for protein levels or fluorescent reporters for ER stress .

  • Statistical analysis plan: Determine appropriate statistical tests and sample sizes needed to detect meaningful differences .

What are the optimal conditions for expressing and purifying recombinant Pongo abelii TMEM111?

For optimal expression and purification of recombinant Pongo abelii TMEM111, researchers should consider:

Expression system selection:

  • Mammalian cell systems may provide better post-translational modifications

  • Bacterial systems might offer higher yield but potentially less functional protein

Purification protocol:

  • Extraction using a Tris-based buffer with detergents suitable for membrane proteins

  • Purification via affinity chromatography using an appropriate tag (determined during production process)

  • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Working aliquots should be kept at 4°C for up to one week

Critical considerations:

  • Avoid repeated freezing and thawing as this can compromise protein integrity

  • For functional studies, verify protein folding using circular dichroism or other structural assessment methods

  • Validate purified protein activity through appropriate functional assays specific to TMEM111's role in the EMC complex

How does TMEM111/EMC3 coordinate with other components of the ER membrane protein complex?

TMEM111/EMC3 functions as a key component within the larger ER membrane protein complex. Research indicates that EMC3 coordinates with other EMC subunits to facilitate several critical cellular processes:

  • Protein folding machinery: EMC3 works cooperatively with Emc1 and Emc2 to form a complex with ER-associated degradation (ERAD) pathway components including Ubac2 and Derlin-2, establishing a direct link between the EMC and ERAD systems .

  • Membrane protein assembly: The EMC complex containing TMEM111/EMC3 is essential for the assembly of various multipass membrane proteins, including nicotinic acetylcholine receptors (AChRs) in Caenorhabditis elegans and rhodopsin in Drosophila and Danio .

  • TA protein insertion: TMEM111/EMC3 plays a significant role in the EMC pathway for insertion of tail-anchored (TA) proteins into the ER membrane. This function complements the GET pathway, with the EMC showing preference for substrates with more hydrophilic transmembrane domains (TMDs) .

Research suggests that disruption of TMEM111/EMC3 function leads to accumulation of misfolded membrane proteins and triggering of the unfolded protein response (UPR), indicating its crucial role in maintaining ER homeostasis .

What role does TMEM111 play in tail-anchored (TA) protein quality control?

TMEM111, as part of the EMC complex, plays a critical role in tail-anchored (TA) protein quality control through several mechanisms:

  • TA protein insertion: The EMC complex facilitates the insertion of TA proteins with relatively hydrophilic TMDs into the ER membrane. This process is particularly important for TA proteins that might not be optimal substrates for the GET pathway .

  • Dynamic quality control cycles: Rather than functioning through a single high-fidelity insertion event, TMEM111 contributes to kinetically driven cycles of insertion and extraction that maintain proper partitioning of TA proteins between organelles. Research indicates that "growing evidence suggests that kinetically driven cycles of insertion and extraction–rather than a single, high-fidelity insertion event–best explain the observed, steady-state partitioning of many membrane proteins" .

  • Coordination with extraction machinery: EMC works in concert with extraction mechanisms involving ATP13A1 (Spf1 in yeast), an ER-resident ATPase that recognizes and extracts mislocalized mitochondrial TA proteins from the ER membrane .

  • Prevention of mislocalization: By ensuring proper insertion of TA proteins, TMEM111/EMC prevents the aberrant accumulation of these proteins at incorrect membranes, which could otherwise impair cellular function .

Experimental data suggests that without proper EMC function, cells experience constitutive delivery of some TA proteins (like BNIP3) to the ER, demonstrating the complex's importance in maintaining organelle identity through proper protein localization .

What are the recommended protocols for studying TMEM111 interactions with other cellular components?

For investigating TMEM111 interactions with other cellular components, researchers should employ multiple complementary approaches:

Co-immunoprecipitation (Co-IP) studies:

  • Prepare cell lysates using a buffer containing 50mM HEPES pH 7.4, 40mM NaCl, 2mM EDTA, 1% Triton X-100, and protease inhibitors

  • Clear lysates by centrifugation at 1000g for 8 minutes

  • Normalize total protein using BCA protein assay

  • Perform immunoprecipitation with antibodies against TMEM111 or suspected interaction partners

  • Analyze precipitates using SDS-PAGE and Western blotting

Proximity labeling approaches:

  • BioID or APEX2-based proximity labeling can identify proteins in close spatial proximity to TMEM111 in living cells

  • These methods are particularly valuable for mapping transient interactions within membrane environments

Fluorescence microscopy for co-localization:

  • Use fluorescently tagged TMEM111 alongside markers for ER, mitochondria, and other organelles

  • Dual-color imaging can assess co-localization with potential interaction partners

  • Consider using techniques like FRET to evaluate direct protein-protein interactions

Functional validation assays:

  • Employ gene knockdown/knockout followed by rescue experiments with wild-type or mutant TMEM111

  • Measure effects on protein folding, ER stress, and membrane protein assembly

How can researchers effectively design experiments to study the impact of TMEM111 mutations on cellular function?

To effectively study the impact of TMEM111 mutations on cellular function, researchers should implement a multi-faceted experimental design:

1. Mutation selection and generation:

  • Identify naturally occurring variants from databases or literature

  • Generate targeted mutations in conserved domains using site-directed mutagenesis

  • Consider creating a panel of mutations spanning different functional regions of TMEM111

2. Expression system selection:

  • For cellular studies, use CRISPR-Cas9 to introduce mutations at the endogenous locus

  • Alternatively, express mutant proteins in TMEM111-knockout backgrounds to avoid interference from endogenous protein

3. Functional readouts:

  • ER stress markers: Monitor UPR activation through XBP1 splicing, ATF6 cleavage, and PERK phosphorylation

  • Membrane protein assembly: Assess the assembly of known EMC-dependent proteins

  • Protein-protein interactions: Compare interaction profiles of wild-type and mutant TMEM111 with other EMC components

4. Rigorous controls:

  • Include wild-type TMEM111 as a positive control

  • Use known non-functional mutants as negative controls

  • Employ rescue experiments to confirm specificity of observed phenotypes

5. Cross-species validation:

  • Test equivalent mutations in model organisms like yeast, C. elegans, or Drosophila

  • Compare phenotypes to assess evolutionary conservation of function

This approach allows for systematic characterization of how specific mutations affect TMEM111 function and provides insights into structure-function relationships within the protein.

How should researchers interpret contradictory data regarding TMEM111 function in different experimental systems?

When encountering contradictory data regarding TMEM111 function across different experimental systems, researchers should employ a systematic analytical approach:

1. System-specific context evaluation:

  • Consider inherent differences between experimental systems (yeast, human cells, etc.)

  • Analyze expression levels of other EMC components in each system

  • Evaluate potential compensatory mechanisms that might be present in some systems but not others

2. Methodological differences analysis:

  • Create a detailed comparison table of experimental methods used across studies

  • Identify critical differences in protein expression, purification, or functional assays

  • Consider whether contradictions stem from technical artifacts or genuine biological differences

3. Integrate family-based, quasi-experimental designs:
When possible, implement designs that allow for causal inference while controlling for genetic background effects. This approach can help distinguish between contradictions arising from genetic variability versus experimental conditions .

Example analysis framework for contradictory findings:

StudyExperimental SystemTMEM111 Expression MethodKey FindingsPotential Confounding Factors
Study AHuman HEK293 cellsEndogenousEMC primarily functions in TA protein insertionHigh expression of GET pathway components
Study BYeastHeterologous expressionEMC primarily functions in protein foldingLacks some mammalian EMC interactors
Study CDrosophilaTissue-specific knockdownEMC required for rhodopsin assemblyDevelopmental compensation possible

4. Resolution strategies:

  • Design experiments that directly test competing hypotheses

  • Perform simultaneous analysis in multiple systems under identical conditions

  • Consider that TMEM111 may have multiple, context-dependent functions

What advanced approaches can be used to study the structural dynamics of TMEM111 within the ER membrane?

To investigate the structural dynamics of TMEM111 within the ER membrane, researchers should consider these advanced approaches:

1. Cryo-electron microscopy (Cryo-EM):

  • Enables visualization of TMEM111 within the native EMC complex

  • Can reveal conformational changes during different functional states

  • Resolution has improved to near-atomic levels for membrane protein complexes

2. Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Provides information about protein dynamics and solvent accessibility

  • Can identify regions of TMEM111 that undergo conformational changes during interaction with substrates

  • Particularly useful for mapping interaction interfaces with other EMC components

3. Single-molecule fluorescence resonance energy transfer (smFRET):

  • Allows real-time monitoring of distance changes between labeled residues

  • Can detect conformational changes during the protein insertion cycle

  • Provides insights into the dynamics of TMEM111 function at the single-molecule level

4. Molecular dynamics simulations:

  • Computational approach to model TMEM111 behavior in a lipid bilayer environment

  • Can predict conformational changes and dynamic interactions with other proteins

  • Helps generate hypotheses that can be tested experimentally

5. Cross-linking mass spectrometry (XL-MS):

  • Identifies residues in close proximity within the native protein complex

  • Provides spatial constraints for structural modeling

  • Particularly valuable for mapping TMEM111 interactions with other EMC components and substrates

These approaches, when used in combination, provide complementary data that can resolve the structural dynamics of TMEM111 functioning within the ER membrane environment.

What are common pitfalls in TMEM111 functional studies and how can they be addressed?

Researchers frequently encounter several challenges when studying TMEM111 function. Here are common pitfalls and their solutions:

1. Protein aggregation during purification:

  • Problem: Membrane proteins like TMEM111 often aggregate during extraction from membranes

  • Solution: Optimize detergent selection; consider using mild detergents like DDM or LMNG; add stabilizing agents like glycerol (50%); maintain samples at 4°C during purification

2. Functional redundancy masking phenotypes:

  • Problem: Other EMC components or parallel pathways may compensate for TMEM111 dysfunction

  • Solution: Consider combinatorial knockdown/knockout approaches; use acute protein depletion systems like auxin-inducible degrons; employ stress conditions that may overwhelm compensatory mechanisms

3. Difficulties distinguishing direct from indirect effects:

  • Problem: TMEM111 disruption can trigger broad ER stress responses, making it challenging to identify direct targets

  • Solution: Use time-course experiments to identify earliest affected processes; employ proximity labeling to identify direct interactors; perform rescue experiments with targeted TMEM111 variants

4. Variability between experimental systems:

  • Problem: Results from different cell types or model organisms may appear contradictory

  • Solution: Directly compare TMEM111 function across systems under identical conditions; consider evolutionary differences in the EMC complex; validate key findings in multiple systems

5. Technical challenges in membrane protein imaging:

  • Problem: High background and poor signal-to-noise ratio when imaging membrane proteins

  • Solution: Optimize fixation protocols for membrane preservation; use super-resolution microscopy techniques; consider split-fluorescent protein approaches for detecting specific interactions

How can researchers validate that their recombinant TMEM111 maintains native functionality?

Validating the native functionality of recombinant TMEM111 is crucial for meaningful research. Researchers should implement these validation approaches:

1. Structural integrity assessment:

  • Circular dichroism spectroscopy to verify secondary structure elements

  • Size-exclusion chromatography to confirm proper oligomeric state

  • Limited proteolysis to assess proper folding (correctly folded proteins often have distinct proteolytic patterns)

2. Functional complementation assays:

  • Express recombinant TMEM111 in cells depleted of endogenous protein

  • Measure rescue of phenotypes like ER stress, defects in membrane protein assembly, or growth defects in yeast models

  • Compare activity metrics between endogenous and recombinant protein

3. Interaction partner verification:

  • Confirm ability to associate with other EMC components via co-immunoprecipitation

  • Verify subcellular localization to the ER membrane using fluorescence microscopy

  • Assess binding to known substrate proteins

4. Activity assays specific to TMEM111 function:

  • Measure ability to facilitate insertion of model TA proteins into membranes

  • Assess protection of model substrates from aggregation

  • Quantify prevention of UPR activation in complementation systems

5. Comparative analysis with native protein:

  • When possible, extract native TMEM111 complex and compare biochemical properties

  • Use cross-linking mass spectrometry to compare interaction profiles

  • Assess post-translational modifications present in native versus recombinant protein

Implementing multiple validation approaches provides stronger evidence for the functional integrity of recombinant TMEM111 preparations.

What are promising research directions for understanding TMEM111's role in disease states?

Several promising research directions could elucidate TMEM111's potential roles in disease states:

1. Neurological disorders investigation:
Given the EMC complex's role in the assembly of membrane proteins like rhodopsin and acetylcholine receptors, researchers should investigate TMEM111 dysfunction in:

  • Neurodegenerative diseases characterized by protein misfolding

  • Disorders involving defective neurotransmitter receptor trafficking

  • Conditions with ER stress as a pathological component

2. Cancer biology exploration:

  • Analyze TMEM111 expression patterns across cancer types using transcriptomic databases

  • Investigate whether altered TMEM111 function affects cancer cell survival under ER stress

  • Explore potential relationships between TMEM111 and cancer drug resistance mechanisms

3. Developmental disorder connections:
Research on related ER membrane proteins like TMEM208 has shown connections to developmental abnormalities:

  • TMEM208 loss affects cell polarity and development

  • Human TMEM208 variants are associated with developmental delay and skeletal abnormalities

  • Similar investigations of TMEM111 variants may reveal developmental functions

4. Metabolic disease links:

  • Study TMEM111's potential role in lipid homeostasis through its ER membrane functions

  • Investigate connections to disorders characterized by defective protein trafficking

  • Explore potential involvement in diseases affecting organelle contacts and communication

5. Genetic variation analysis:

  • Conduct systematic analysis of human TMEM111 variants from population databases

  • Perform functional characterization of variants associated with disease phenotypes

  • Develop animal models with equivalent mutations to study physiological consequences

How might emerging technologies advance our understanding of TMEM111 function and dynamics?

Emerging technologies offer exciting opportunities to deepen our understanding of TMEM111:

1. Cryo-electron tomography:

  • Enables visualization of TMEM111/EMC in its native cellular environment

  • Can reveal structural organization within the ER membrane

  • May identify different conformational states during substrate processing

2. Genome-wide CRISPR screens:

  • Identify genetic interactions with TMEM111/EMC3

  • Discover redundant or compensatory pathways

  • Map the broader network of genes affecting TMEM111 function

3. Organoid and tissue-specific models:

  • Study TMEM111 function in physiologically relevant 3D tissue contexts

  • Assess tissue-specific requirements for TMEM111 activity

  • Examine consequences of TMEM111 dysfunction in complex cellular environments

4. Single-cell multi-omics approaches:

  • Integrate transcriptomics, proteomics, and metabolomics at single-cell resolution

  • Identify cell-specific responses to TMEM111 perturbation

  • Map heterogeneity in TMEM111 expression and function across cell types

5. Advanced imaging technologies:

  • Live-cell super-resolution microscopy to track TMEM111 dynamics

  • Correlative light and electron microscopy to link function to ultrastructure

  • Expansion microscopy to visualize TMEM111 within the crowded ER environment

6. AI-powered structure prediction and protein design:

  • Use AlphaFold or similar tools to predict TMEM111 structure and interactions

  • Design modified versions of TMEM111 with enhanced or altered functions

  • Generate testable hypotheses about structure-function relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.