Recombinant Pongo abelii Transmembrane protein 176B (TMEM176B)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Pongo abelii TMEM176B is a 270-amino acid transmembrane protein expressed in E. coli with an N-terminal His tag for purification . Derived from the Sumatran orangutan (Pongo abelii), it corresponds to UniProt ID Q5R8D6 and retains full-length sequence fidelity . Key production parameters include:

ParameterSpecification
Expression SystemEscherichia coli (E. coli)
Purification MethodAffinity chromatography via His tag
Purity≥85% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water, with glycerol (5–50%) for long-term stability

Functional Insights

While the recombinant protein itself is primarily a research tool, endogenous TMEM176B regulates:

  • Immune Checkpoints: Inhibits NLRP3 inflammasome activation and modulates CD8+/Treg ratios .

  • Cancer Pathways: Upregulated in gastric cancer (GC) and linked to tumor size, invasion depth, and lymph node metastasis .

  • Fibrosis: Suppresses TGFβ1-SMAD signaling, reducing fibroblast-to-myofibroblast differentiation in pulmonary fibrosis .

Immune Oncology

  • TMEM176B knockdown enhances CD8+ T-cell infiltration and synergizes with anti-CTLA-4 therapy in melanoma models .

  • Overexpression reduces IL-1β secretion, impairing inflammasome activity in macrophages .

Cancer Studies

  • In gastric cancer, high TMEM176B expression correlates with advanced tumor size (≥6 cm; p=0.002), deeper invasion (p=0.021), and lymph node metastasis (p=0.032) .

  • Regulates AKT/mTOR signaling in breast cancer, influencing tumor growth and immune evasion .

Fibrosis and Lung Disease

  • Adenoviral TMEM176B overexpression in mice attenuates bleomycin-induced pulmonary fibrosis by 40–60%, improving lung compliance and reducing hydroxyproline deposition .

Comparative Analysis with Orthologs

SpeciesUniProt IDSequence IdentityKey Functional Differences
Pongo abeliiQ5R8D6100%Used in cross-species immune response studies .
Homo sapiensQ3YBM298%Linked to PD-1/PD-L1 signaling in melanoma .
Mus musculusQ8K2I385%Knockout models show enhanced antitumor immunity .

Technical Challenges and Limitations

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; aliquoting in glycerol is critical .

  • Species-Specific Variations: Functional disparities between primate and murine orthologs complicate translational research .

  • Application Constraints: Primarily validated for SDS-PAGE and ELISA; lacks functional data in live-cell assays .

Future Directions

  • Mechanistic Studies: Clarify TMEM176B’s dual role in promoting cancer progression while enhancing antitumor immunity .

  • Therapeutic Development: Explore recombinant TMEM176B as a biologic for fibrosis or immune augmentation .

  • Structural Biology: Resolve cryo-EM structures to map ion channel domains and ligand-binding sites .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
TMEM176B; Transmembrane protein 176B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM176B
Target Protein Sequence
MTQNTVIVNGVAMDSRPSQPTHINVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARI GYEQLALGVTQILLGVLSCALGVCLSLGPWTVLRASGCAFWAGSVAIAAGAGAIVHEKYP GKLAGYVSSLLTLAGFATVMAAVVLCVNSFIWQTEPFLYIDTVCDRSDPVIPTTGYGWMW RSEEIQRQKEECRAYMQMLRKLFTAIRALFLAVCVLKVIVSLASLGVGLRNLCGQSSQPL NEEGSEKRLLGENSVPPSPSREQTSTAIVL
Uniprot No.

Target Background

Function
TMEM176B may play a role in the maturation process of dendritic cells. It is also essential for the development of cerebellar granule cells.
Database Links

KEGG: pon:100174564

UniGene: Pab.12754

Protein Families
TMEM176 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.