Recombinant Pongo abelii Transmembrane protein 184C (TMEM184C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM184C; TMEM34; Transmembrane protein 184C; Transmembrane protein 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-438
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM184C
Target Protein Sequence
MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTI PISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAY VIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYT VVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELS PIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIE MFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRRVGRTVRGHPRK KLFPEDQDQNEHTSLLSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEI LSDTIGEKKEPSDKSVDS
Uniprot No.

Target Background

Function
This protein is a potential tumor suppressor and may play a role in cell growth.
Database Links

KEGG: pon:100174241

UniGene: Pab.12136

Protein Families
TMEM184 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does Pongo abelii TMEM184C compare structurally to human TMEM184C?

The Pongo abelii TMEM184C shares significant sequence homology with human TMEM184C, reflecting their evolutionary relationship. Comparative analysis reveals conservation of key structural domains, particularly within the transmembrane regions. The amino acid sequence of Pongo abelii TMEM184C (UniProt: Q5RET6) includes several conserved motifs present across species . This conservation suggests functional importance of these regions. When designing experiments using the orangutan protein as a model for human studies, researchers should consider both the similarities and any species-specific variations, particularly in signaling domains or post-translational modification sites that might affect functional output.

What expression systems are optimal for recombinant TMEM184C production?

For recombinant TMEM184C expression, several systems have proven effective depending on research requirements:

Expression SystemAdvantagesConsiderations
Mammalian cell lines (HEK293, CHO)Native-like post-translational modifications; Proper folding of transmembrane regionsHigher cost; Slower production times
Insect cells (Sf9, High Five)Moderate yield; Eukaryotic processingGlycosylation patterns differ from mammals
E. coli systemsHigh yield; Cost-effectiveChallenges with proper folding; Lacks post-translational modifications

For functional studies, mammalian expression systems are often preferred as they provide the most physiologically relevant modifications and folding environments. For structural studies requiring higher yields, insect cell systems offer a good compromise between yield and proper protein processing . When expressing TMEM184C, inclusion of affinity tags should be carefully considered as they may interfere with transmembrane domain function.

What strategies are effective for investigating TMEM184C's role in tumor suppression?

Investigating TMEM184C's potential tumor suppressive functions requires multifaceted approaches:

  • Gene expression modulation: Utilize adenoviral vectors expressing TMEM184C (similar to the rat TMEM184C adenovirus approach) to study overexpression effects on cell growth parameters . Complementarily, employ CRISPR-Cas9 or siRNA knockdown to assess loss-of-function phenotypes.

  • Cell proliferation assays: Compare proliferation rates between TMEM184C-overexpressing, wild-type, and TMEM184C-depleted cells using MTT, BrdU incorporation, or live-cell imaging techniques.

  • Apoptosis evaluation: Determine if TMEM184C expression affects apoptotic pathways using Annexin V/PI staining and caspase activation assays.

  • Migration and invasion studies: Given findings with related protein TMEM184B in cancer contexts, assess TMEM184C's impact on cell motility using scratch assays, Boyden chamber assays, and real-time invasion monitoring .

  • Signaling pathway analysis: Investigate TMEM184C's intersection with established growth regulatory pathways (Wnt, MAPK, PI3K/AKT) through phosphorylation status assessment of downstream effectors.

The experimental design should include appropriate positive and negative controls, and multiple cell lines to establish reproducibility across different genetic backgrounds.

How can researchers resolve contradictory findings regarding TMEM184C function?

Contradictory findings in TMEM184C research can be approached methodically:

  • Context dependency analysis: Systematically evaluate whether discrepancies arise from differences in cellular contexts by conducting parallel experiments in multiple cell types. Create a comprehensive table documenting experimental conditions across contradictory studies.

  • Isoform-specific effects: Determine whether contradictions result from studying different isoforms or splice variants of TMEM184C. Design PCR primers to distinguish between variants and quantify their expression ratios in relevant tissues.

  • Post-translational modification profiling: Assess whether functional differences correlate with differential post-translational modifications using mass spectrometry and phospho-specific antibodies.

  • Interactome comparison: Identify cell-type or condition-specific protein interaction partners using proximity labeling approaches (BioID, APEX) combined with mass spectrometry to elucidate differential protein complexes.

  • Subcellular localization studies: Investigate whether functional differences correlate with altered subcellular distribution using fractionation and imaging approaches.

Researchers should conduct these investigations with transparent reporting of all variables to facilitate future reconciliation of contradictory findings.

What are the key considerations for designing TMEM184C functional studies across different species?

When designing cross-species functional studies of TMEM184C:

  • Evolutionary conservation mapping: Perform comprehensive sequence alignment and structural prediction across species, focusing on conservation of functional domains and regulatory regions. This provides insight into which aspects of TMEM184C function may be evolutionarily conserved versus species-specific.

  • Model system selection: Choose model systems based on specific research questions. For basic mechanistic studies, simpler systems like zebrafish may be appropriate, while for studies more directly relevant to human disease, primate models including Pongo abelii-derived systems may be preferable .

  • Ortholog validation: Confirm functional equivalence through rescue experiments, where the ortholog from one species is expressed in cells from another species with TMEM184C knockdown to assess functional complementation.

  • Domain-specific analysis: Use chimeric proteins containing domains from different species to identify species-specific functional regions.

  • Regulatory context consideration: Assess whether species differences in TMEM184C function may result from differences in regulatory networks rather than intrinsic protein function through comparative transcriptomics and proteomics.

These approaches allow researchers to distinguish conserved functions from species-specific adaptations.

What are the optimal approaches for studying TMEM184C protein-protein interactions?

To elucidate TMEM184C's interactome, researchers should consider these methodological approaches:

  • Proximity-based labeling: BioID or APEX2 fusions with TMEM184C allow identification of proximal proteins in living cells, particularly valuable for transmembrane proteins where traditional co-immunoprecipitation may disrupt important interactions.

  • Split-reporter systems: Techniques like split-GFP or split-luciferase can confirm direct interactions with suspected binding partners in cellular contexts.

  • Crosslinking mass spectrometry (XL-MS): Chemical crosslinking followed by mass spectrometry can capture transient or weak interactions in native environments.

  • Co-immunoprecipitation with optimized detergents: Selective use of mild detergents (DDM, CHAPS) can solubilize membrane proteins while preserving interactions.

  • Yeast two-hybrid membrane system modifications: Specialized membrane yeast two-hybrid systems can be employed for screening potential interaction partners.

When analyzing data from these experiments, it's essential to distinguish between direct binding partners and components of larger complexes through validation with multiple complementary techniques.

What experimental design considerations are critical when studying the effects of TMEM184C variants?

When investigating TMEM184C variants, particularly those potentially associated with disease:

  • Expression system selection: Consider whether the variant affects protein folding/trafficking, which might necessitate mammalian expression systems rather than bacterial or cell-free systems.

  • Functional readout relevance: Select assays that directly measure the suspected function affected by the variant. For example, if studying variants in regions analogous to those in TMEM184B linked to neurodevelopmental disorders, neuronal differentiation assays may be appropriate .

  • Statistical power calculations: Perform power analyses to determine appropriate sample sizes for detecting subtle phenotypic effects, particularly for variants with incomplete penetrance.

  • Controls and normalization strategy:

    • Include wild-type TMEM184C as positive control

    • Use empty vector transfection as negative control

    • Consider including known loss-of-function variants as reference points

    • Normalize expression levels across variants to ensure comparable protein levels

  • Temporal considerations: Establish appropriate timeframes for observing phenotypic effects, particularly for processes like differentiation or development that occur over extended periods.

These design considerations help ensure that observed effects are specifically attributable to the variant under study rather than experimental artifacts.

What cellular assays are most informative for evaluating TMEM184C function in growth regulation?

Based on known roles of TMEM184C and related proteins in growth regulation, these assays provide comprehensive functional evaluation:

  • Real-time cell proliferation monitoring: Use impedance-based systems (xCELLigence) or live-cell imaging platforms with automated cell counting to assess proliferation kinetics rather than endpoint measurements.

  • Cell cycle analysis: Flow cytometry with propidium iodide or EdU incorporation provides detailed information about cell cycle progression effects.

  • Metabolic activity profiling: Measure cellular energy metabolism using Seahorse XF analysis to determine if TMEM184C affects glycolytic or oxidative phosphorylation pathways.

  • Clonogenic assays: Assess long-term growth effects through colony formation assays, particularly relevant for tumor suppressor studies.

  • 3D culture systems: Evaluate growth regulation in more physiologically relevant contexts using spheroid or organoid models, which may reveal functions not apparent in 2D cultures.

Assay TypeMeasurementAdvantageLimitation
Real-time monitoringContinuous proliferation curveCaptures kinetic differencesHigher equipment cost
Cell cycle analysisPhase distributionMechanistic insightPoint-in-time measurement
Metabolic profilingEnergy pathway utilizationFunctional mechanism dataIndirect growth measure
Clonogenic assayLong-term proliferative capacityReveals subtle effectsTime-consuming (7-14 days)
3D cultureGrowth in tissue-like contextPhysiological relevanceMore complex analysis

The integration of multiple assay types provides complementary data for comprehensive functional characterization.

What are the critical parameters for optimizing immunodetection of TMEM184C in experimental systems?

Detecting TMEM184C presents challenges typical of transmembrane proteins:

  • Epitope accessibility: For antibody-based detection, consider epitope location relative to membrane topology. N- or C-terminal epitopes are generally more accessible than transmembrane regions, but their orientation must be considered when designing fixation and permeabilization protocols.

  • Fixation optimization:

    • For preserved membrane structure: 2-4% paraformaldehyde (10-15 minutes)

    • For enhanced intracellular epitope access: Methanol fixation (-20°C, 10 minutes)

    • For balanced preservation: Combined PFA/methanol protocols

  • Detergent selection for Western blotting: Use specialized extraction buffers:

    • RIPA buffer with 0.5% sodium deoxycholate for general extraction

    • Digitonin (0.5-1%) for milder solubilization preserving protein complexes

    • Sample heating at 37°C rather than boiling to prevent aggregation

  • Blocking optimization: Use 5% BSA rather than milk for membrane proteins to reduce background when probing hydrophobic regions.

  • Signal amplification: Consider proximity ligation assays or tyramide signal amplification when dealing with low expression levels.

These parameter optimizations significantly improve detection sensitivity and specificity for transmembrane proteins like TMEM184C.

How can researchers effectively design experiments to investigate TMEM184C's role in nutrient signaling pathways?

Given indications that related proteins impact nutrient signaling pathways, including TFEB regulation , researchers can design targeted experiments:

  • Nutrient deprivation paradigms: Establish protocols with specific nutrient restriction profiles:

    • Amino acid starvation (EBSS medium)

    • Glucose limitation (reducing glucose from 25mM to 1mM)

    • Combined nutrient restriction

    • mTOR inhibition with rapamycin or Torin1 as positive controls

  • TFEB nuclear translocation quantification:

    • Stable cell lines expressing TFEB-sfGFP for live imaging

    • High-content imaging with automated nuclear/cytoplasmic intensity ratio calculation

    • Time-course analysis to capture dynamic responses

  • Lysosomal function assessment:

    • LysoTracker staining for lysosomal mass quantification

    • Magic Red cathepsin substrates for lysosomal enzyme activity

    • Lysosomal pH measurement using ratiometric probes

  • Autophagy pathway analysis:

    • LC3-II/I ratio measurement by Western blot

    • Autophagy flux assessment with bafilomycin A1

    • p62/SQSTM1 clearance assays

  • mTOR pathway activity monitoring:

    • Phospho-specific antibodies against S6K and 4E-BP1

    • Time-resolved analysis following nutrient reintroduction

When implementing these approaches, researchers should establish clear time-courses and dose-responses to fully characterize the signaling dynamics.

What statistical approaches are most appropriate for analyzing TMEM184C expression data across tissue types?

For robust statistical analysis of TMEM184C expression:

  • Normalization strategy selection:

    • For RNA-seq: TPM or FPKM normalization with appropriate batch effect correction

    • For proteomics: Global median normalization or internal standards

    • Consider tissue-specific reference genes rather than global housekeeping genes

  • Differential expression analysis:

    • For parametric data: ANOVA with post-hoc tests for multiple tissue comparisons

    • For non-parametric data: Kruskal-Wallis with Dunn's test

    • Implement Benjamini-Hochberg correction for multiple testing

  • Correlation analysis:

    • Pearson or Spearman correlation between TMEM184C and functionally related genes

    • Network-based approaches to identify co-expression modules

  • Visualization approaches:

    • Heat maps with hierarchical clustering to identify tissue-specific patterns

    • Principal component analysis to visualize relationships between tissues

  • Integration with functional data:

    • Gene Set Enrichment Analysis (GSEA) to identify pathways correlated with TMEM184C expression

    • Correlation with phenotypic data where available

These approaches help distinguish biologically meaningful patterns from technical variation in expression datasets.

How should researchers approach comparative analysis between TMEM184C and related family members like TMEM184B?

For effective comparative analysis between TMEM184 family members:

  • Sequence-structure-function mapping:

    • Perform multiple sequence alignments to identify conserved domains

    • Map known functional residues from TMEM184B (like those implicated in neurodevelopmental disorders ) onto TMEM184C structure

    • Generate structural predictions using AlphaFold or RoseTTAFold to compare protein architectures

  • Expression pattern comparison:

    • Create comprehensive tissue expression profiles for each family member

    • Calculate correlation coefficients between expression patterns

    • Identify tissues with divergent expression suggesting specialized functions

  • Phenotypic comparison in model systems:

    • Conduct parallel knockdown/knockout experiments of different family members

    • Design rescue experiments where one family member is expressed in cells lacking another

    • Quantify degree of functional complementation between family members

  • Pathway analysis:

    • Compare interaction partners identified for different family members

    • Identify shared vs. distinct signaling pathways

    • Construct integrated network models highlighting unique and overlapping functions

This systematic comparative approach helps define both redundant and specific functions within the TMEM184 family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.