Recombinant Pongo abelii Transmembrane protein 192 (TMEM192)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Lysosomal Biology

TMEM192 is implicated in:

  • Lysophagy Regulation: The TMEM192-mKeima probe specifically assays lysophagy (lysosome-specific autophagy), demonstrating higher specificity than conventional galectin-3 assays .

  • mTORC1 Signaling: Depletion of TMEM192 or its interactor STK11IP reduces ribosomal protein S6 phosphorylation, linking it to autophagy modulation .

  • Lysosomal Stability: Despite its lysosomal localization, TMEM192 knockout mice show no overt lysosomal dysfunction, suggesting compensatory mechanisms .

Experimental Tools

  • Plasmid Constructs: pLJC5-Tmem192-3xHA enables lysosomal tagging in human cells for organelle isolation and metabolomic studies .

  • Antibodies: Anti-TMEM192 monoclonal antibodies (e.g., ab186737) are validated for Western blot (31 kDa band) and intracellular flow cytometry .

Key Findings Using Recombinant TMEM192

StudyKey InsightCitation
Lysosomal Damage ResponseTMEM192-mKeima identifies UBE2L3, UBE2N, and TRIM proteins as lysophagy factors
STK11IP InteractionTMEM192 recruits STK11IP to lysosomes, regulating mTORC1 signaling
Autophagy-Apoptosis CrosstalkTMEM192 knockdown in hepatoma cells dysregulates autophagy and increases apoptosis

Unresolved Questions and Future Directions

While TMEM192’s role in lysosomal dynamics is established, its molecular mechanisms remain unclear. Key areas for investigation include:

  • The functional significance of its tissue-specific proteolytic processing .

  • How TMEM192-STK11IP interactions modulate mTORC1 activity independent of canonical nutrient-sensing pathways .

  • Redundancy mechanisms compensating for TMEM192 loss in knockout models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM192; Transmembrane protein 192
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM192
Target Protein Sequence
MAAGGRMEDGSLDITQSIEDDPLLDAQLLPHHSLQAHFRPRFHPLPTVIIVNLLWFIHLV FVILAFLTGVLCSYPNPNEDKCPGNYTNPLKVQTVIILGKVILWILHLLLECYIQYHHSK IRNRGYNLIYRSTRHLKRLALMIRSSGNTVLLLILCMQHSFPEPGRLYLDLILAILALEL ICSLICLLIYTVKIRRFNKAKPEPDILEEEKIYAYPSNITSETGFRTISSLEEIVEKQGD TIEYLKRHNALLSKRLLALTSSDLGCQPSRT
Uniprot No.

Target Background

Database Links
Protein Families
TMEM192 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Late endosome.

Q&A

How does Pongo abelii TMEM192 differ from human TMEM192?

Pongo abelii (Sumatran orangutan) TMEM192 shares high sequence homology with human TMEM192, reflecting their evolutionary relationship. The Pongo abelii variant has UniProt accession number Q5RCG1 . While the core functions appear conserved, researchers should note these key comparisons:

FeaturePongo abelii TMEM192Human TMEM192
Length271 amino acids271 amino acids
Key domainsConserved transmembrane regionsConserved transmembrane regions
Functional roleLysosomal membrane proteinLysosomal membrane protein
ConservationHigh sequence similarity to humanReference sequence
UniProt IDQ5RCG1Q8IY95

This high conservation suggests that findings from experiments using Pongo abelii TMEM192 may have translational relevance for human studies, though species-specific differences should be considered when interpreting results .

What are the primary cellular functions of TMEM192?

TMEM192 primarily functions as a lysosomal membrane protein involved in several critical cellular processes:

  • Lysosomal membrane integrity: TMEM192 contributes to maintaining the structural integrity of lysosomes, which are vital for cellular degradation processes .

  • Lysophagy marker: When fused with fluorescent proteins like mKeima, TMEM192 serves as an excellent marker for tracking lysophagy—the selective autophagy of damaged lysosomes .

  • Protein-protein interactions: TMEM192 interacts with other proteins such as STK11IP (serine/threonine kinase 11-interacting protein), recruiting them to the lysosomal membrane. The STK11IP-TMEM192 complex, known as LyTS (Lysosome localized complex of TMEM192 and STK11IP), plays a role in lysosomal signaling pathways .

  • Lysosomal damage response: TMEM192 is instrumental in cellular responses to lysosomal damage, providing a means to monitor the fate of damaged lysosomes .

How is the TMEM192-mKeima probe designed and how does it function?

The TMEM192-mKeima probe is a fusion protein designed to specifically assay lysophagy—the selective autophagy of damaged lysosomes. The probe consists of:

  • TMEM192: A lysosomal transmembrane protein that localizes the probe to the lysosomal membrane

  • mKeima: A pH-sensitive fluorescent protein with dual-excitation properties

The probe functions based on mKeima's unique spectral properties:

  • At neutral pH (cytosol): Excited primarily at 445 nm

  • At acidic pH (lysosomal lumen): Shows stronger excitation at 594 nm

When lysosomes containing TMEM192-mKeima are damaged and subsequently engulfed by autophagosomes that fuse with healthy lysosomes, the probe ends up in an acidic environment, causing a shift in its fluorescence properties from 445 nm to 594 nm excitation wavelengths .

This ratiometric change allows researchers to quantitatively track the process of lysophagy by measuring the number of TMEM192-mKeima puncta in acidic compartments during recovery from lysosomal damage. The number of these puncta increases with incubation time after lysosomal damage induction and correlates positively with the concentration of lysosomal damaging agents like LLOMe (L-leucyl-L-leucine methyl ester) .

What advantages does TMEM192-mKeima offer over conventional lysosomal damage assays?

The TMEM192-mKeima probe offers several significant advantages over conventional assays such as the galectin-3 assay:

FeatureTMEM192-mKeimaConventional Galectin-3 Assay
SpecificitySpecifically assays lysophagyDetects general lysosomal membrane damage
Signal originDirect measurement of lysosomes undergoing lysophagyIndirect measurement of galectin-3 recruitment to damaged lysosomes
Pathway distinctionDistinguishes lysophagy from other lysosomal damage responsesMay reflect multiple response pathways (repair, transcription)
QuantificationEnables robust quantitative flux measurementsMore qualitative; challenging to measure flux
False positivesLower rate of false positivesMay detect damage that doesn't lead to lysophagy
Research applicationsEnables specific study of lysophagy factorsLess specific for pathway delineation

The conventional galectin-3 assay may reflect not only lysophagy but also other lysosomal damage responses such as ESCRT-mediated repair and TFEB-mediated transcription. In contrast, the TMEM192-mKeima probe allows researchers to assess lysophagic activity separately from these other pathways .

How can researchers differentiate between basal lysophagy and damage-induced lysophagy using TMEM192?

Differentiating between basal lysophagy and damage-induced lysophagy requires careful experimental design and analysis:

  • Basal lysophagy signals:

    • Under normal conditions, TMEM192-mKeima shows some puncta that may represent the basal level of lysophagy or invagination of the lysosomal membrane through mechanisms like multivesicular body (MVB) formation or microautophagy

    • These signals typically appear as weak puncta at 594 nm excitation

  • Damage-induced lysophagy signals:

    • After lysosomal damage treatment (e.g., with LLOMe), the basal level puncta initially disappear due to loss of lysosomal acidity

    • During recovery, TMEM192-mKeima puncta at 594 nm excitation become more evident than at basal levels and gradually increase in number with incubation time

    • The intensity ratio between 594 nm and 445 nm excitation increases significantly

  • Quantification methodology:

    • Set a threshold for each experiment to account for the fact that TMEM192-mKeima in lysosomes shows weak signals at 445 nm excitation

    • Compare the intensity at 594 nm with the intensity at 445 nm; if this ratio is above the set threshold, consider the puncta as TMEM192-mKeima in an acidic environment

    • Track the number of TMEM192-mKeima puncta in lysosomes over time after damage induction

    • Additionally, observe the correlation between puncta formation and concentration of the damaging agent

A distinctive feature of damage-induced lysophagy is the observation of TMEM192-mKeima signals at 594 nm excitation appearing inside ring-like structures of TMEM192-mKeima signals at 445 nm excitation, indicating the presence of lysosomal membrane within another lysosome—a hallmark of the lysophagy process .

What are the optimal conditions for inducing and monitoring lysosomal damage using TMEM192-based assays?

For optimal lysosomal damage induction and monitoring using TMEM192-based assays, researchers should consider the following experimental conditions:

  • Lysosomal damage induction:

    • LLOMe treatment: The most common method involves using L-leucyl-L-leucine methyl ester (LLOMe)

    • Concentration range: Typically 0.5-2 mM LLOMe, with effectiveness correlating positively with concentration

    • Treatment duration: Short exposure (typically 10-15 minutes) followed by washout

    • Alternative agents: Silica, monosodium urate crystals, bacterial toxins, or β-amyloid can also be used depending on research context

  • Cell preparation:

    • Expression system: Stable expression of TMEM192-mKeima is preferred over transient expression for consistent results

    • Cell density: 60-70% confluence at the time of treatment

    • Pre-treatment culture: At least 24 hours of standard culture conditions before damage induction

  • Imaging parameters:

    • Excitation wavelengths: 445 nm and 594 nm

    • Time-lapse intervals: For dynamic studies, 5-10 minute intervals for up to 12 hours

    • Temperature and CO₂: Maintain physiological conditions (37°C, 5% CO₂) during live imaging

    • Z-stack acquisition: Recommended for accurate puncta quantification

  • Recovery monitoring:

    • Time points: 0, 1, 3, 6, 12, and 24 hours post-damage are typical monitoring points

    • Media replacement: Fresh media after washing out the damaging agent

    • Threshold setting: Carefully calibrate the 594/445 nm intensity ratio threshold for each experimental setup

The number of TMEM192-mKeima puncta typically increases with both incubation time after LLOMe treatment and with the concentration of LLOMe, providing a dose-dependent and time-dependent readout of lysophagy activity .

How should researchers interpret conflicting data from TMEM192-mKeima studies?

When faced with conflicting data from TMEM192-mKeima studies, researchers should systematically evaluate several potential sources of variation:

  • Technical considerations:

    • Signal threshold variability: Different threshold settings for the 594/445 nm ratio can dramatically affect quantification results. Standardize thresholds across experiments.

    • Imaging parameters: Differences in exposure times, detector sensitivity, or microscope calibration can create apparent discrepancies. Use identical acquisition settings for comparative analyses.

    • Cell heterogeneity: Single-cell variations in lysophagy response can be substantial. Analyze sufficient cell numbers (>100 per condition) to obtain statistically robust data.

  • Biological variables:

    • Cell type differences: Different cell types may exhibit varying baseline lysophagy rates and damage responses. Compare results within the same cell type.

    • Expression level effects: TMEM192-mKeima expression levels can affect lysosomal function. Use clonal lines with similar expression levels for comparative studies.

    • Cell cycle stage: Lysosomal damage response may vary with cell cycle. Consider synchronizing cells or analyzing cell cycle-specific responses.

  • Experimental design factors:

    • Timing discrepancies: The lysophagy response is highly dynamic. Small differences in sampling times can yield different results.

    • Damage agent variability: Different batches or sources of damaging agents (e.g., LLOMe) may have varying potencies. Include internal controls with each experiment.

    • Culture condition differences: Subtle variations in media composition, serum lots, or cell density can affect lysophagy. Standardize all culture conditions.

  • Analytical approach:

    • Integrated analysis: When facing conflicting data, integrate multiple readouts beyond TMEM192-mKeima, such as lysosomal enzyme release assays or complementary markers.

    • Genetic validation: Use genetic knockouts of key lysophagy factors to validate that the observed TMEM192-mKeima signals genuinely represent lysophagy.

    • Kinetic resolution: Conflicting endpoint data may be resolved by detailed kinetic analyses across multiple timepoints .

Note that TFEB and p62, previously considered involved in lysophagy, were shown using TMEM192-mKeima to be important for the lysosomal damage response but not for lysophagy specifically—highlighting how this probe can help resolve conflicting or incomplete prior findings .

What controls are essential when working with TMEM192 in experimental systems?

To ensure experimental rigor when working with TMEM192-based systems, the following controls are essential:

  • Expression controls:

    • TMEM192 without mKeima: To control for potential effects of the fluorescent tag on protein function

    • mKeima alone: To control for potential non-specific signals from the fluorescent protein

    • Expression level matching: Ensure similar expression levels across experimental and control cells

  • Treatment controls:

    • Vehicle control: Cells treated with the solvent used for the damaging agent

    • Untreated time course: To account for any time-dependent changes in baseline signals

    • Concentration gradient: Include multiple concentrations of damaging agents to establish dose-response relationships

  • Specificity controls:

    • Autophagy inhibitors: Treatment with bafilomycin A1 or other lysosomal acidification inhibitors to confirm the acidic environment dependence

    • General autophagy markers: Include LC3B staining to distinguish general autophagy from specific lysophagy

    • ATG gene knockouts: Validate TMEM192-mKeima signals are dependent on core autophagy machinery

  • Technical controls:

    • Spectral controls: Single wavelength excitation samples to establish proper emission collection parameters

    • Photobleaching controls: Measure and account for any signal loss due to repeated imaging

    • Fixed intensity threshold: Apply consistent intensity ratio thresholds across all experimental conditions

  • Genetic validation controls:

    • UBE2L3, UBE2N knockouts: As known regulators of lysophagy, these serve as positive controls for lysophagy impairment

    • TFEB knockouts: To distinguish lysophagy from broader lysosomal damage responses

    • TRIM family knockouts: Particularly TRIM10, 16, and 27 as identified regulators of lysophagy

The careful implementation of these controls allows researchers to confidently attribute observed signals to specific biological processes and distinguish lysophagy from other cellular responses to lysosomal damage.

How is TMEM192 being used to investigate the molecular mechanisms of lysophagy?

TMEM192, particularly as part of the TMEM192-mKeima probe, has become instrumental in dissecting the molecular mechanisms of lysophagy through several sophisticated research applications:

  • Pathway delineation studies:

    • TMEM192-mKeima has enabled researchers to distinguish between general lysosomal damage responses and specific lysophagy events

    • This distinction has led to the significant finding that TFEB and p62, previously thought to be involved in lysophagy, are actually important for the lysosomal damage response but not for lysophagy specifically

  • Ubiquitination cascade analysis:

    • The TMEM192-mKeima probe has facilitated the identification of specific E2 ubiquitin-conjugating enzymes involved in lysophagy

    • UBE2L3 and UBE2N have been identified as critical factors in the initial steps of lysophagy

    • This suggests a specific ubiquitination cascade that marks damaged lysosomes for autophagic clearance

  • E3 ubiquitin ligase identification:

    • Research using TMEM192-based approaches has identified TRIM family proteins (TRIM10, TRIM16, and TRIM27) as factors involved in lysophagy

    • These TRIM proteins likely function as E3 ubiquitin ligases in the lysophagy pathway

  • Temporal dynamics investigation:

    • The dual-excitation properties of TMEM192-mKeima allow for real-time monitoring of lysophagy flux

    • This has revealed that lysophagy is a dynamic process with distinct phases of recognition, engulfment, and degradation

  • Comparative analysis of lysosomal damage responses:

    • TMEM192-based assays have enabled researchers to differentiate between three major lysosomal damage response pathways:
      a) ESCRT-mediated membrane repair
      b) TFEB-mediated transcriptional response
      c) Autophagy-dependent lysophagy

    • This distinction has clarified the specific roles and relationships between these parallel response mechanisms

These applications have significantly advanced our understanding of lysophagy as a specific cellular process distinct from general autophagy and other lysosomal damage responses.

What protein interactions of TMEM192 are critical for its function in lysosomal biology?

Several key protein interactions of TMEM192 have been identified as critical for its function in lysosomal biology:

  • STK11IP interaction:

    • STK11IP (serine/threonine kinase 11-interacting protein) is robustly recruited to lysosomes through direct interaction with TMEM192

    • This interaction forms a complex known as LyTS (Lysosome localized complex of TMEM192 and STK11IP)

    • The interaction depends on specific structural elements within TMEM192, particularly features in its C-terminus

  • TRIM family interactions:

    • TRIM10, TRIM16, and TRIM27 have been identified as factors involved in lysophagy that likely interact with the TMEM192-positive lysosomal membrane

    • These interactions appear to be crucial for the ubiquitination of damaged lysosomal membranes, a key step in lysophagy initiation

  • Ubiquitination machinery interactions:

    • UBE2L3 and UBE2N (E2 ubiquitin-conjugating enzymes) functionally interact with TMEM192-positive lysosomal membranes

    • These interactions are likely mediated through adaptor proteins or E3 ligases like the TRIM family proteins

    • The interaction creates a ubiquitination cascade essential for lysophagy

  • Autophagy machinery interactions:

    • Though not directly interacting with TMEM192 itself, the autophagy machinery recognizes ubiquitinated TMEM192-positive lysosomal membranes

    • This recognition facilitates the engulfment of damaged lysosomes by autophagosomes

  • C-terminal domain interactions:

    • AlphaFold2 structural predictions indicate that the most prominent feature within the TMEM192 C-terminus is an alpha helix comprised of amino acids 228-265

    • This region is likely critical for protein-protein interactions that mediate TMEM192's functions

    • Focused mutagenesis of this region may help resolve the precise determinants within TMEM192 that support its various protein interactions

Understanding these protein interactions provides insight into how TMEM192 functions within the complex network of lysosomal homeostasis and damage response pathways.

How can TMEM192 be utilized in studying disease mechanisms related to lysosomal dysfunction?

TMEM192-based approaches offer powerful tools for investigating disease mechanisms related to lysosomal dysfunction:

By providing specific readouts of lysophagy separate from other lysosomal damage responses, TMEM192-based approaches enable more precise characterization of disease mechanisms and therapeutic interventions targeting lysosomal pathways.

What are common challenges in TMEM192-based assays and how can they be addressed?

Researchers frequently encounter several challenges when working with TMEM192-based assays. Here are the most common issues and their solutions:

  • Variable expression levels:

    • Problem: Inconsistent expression of TMEM192-mKeima across cells leads to variable signal intensity and inconsistent results.

    • Solution: Generate stable cell lines with uniform expression levels; use FACS sorting to isolate populations with similar expression levels; include internal calibration standards for normalization.

  • Background autofluorescence:

    • Problem: Cellular autofluorescence, particularly in the red spectrum, can interfere with mKeima signal detection.

    • Solution: Use spectral unmixing algorithms; include non-expressing control cells for background subtraction; minimize media phenol red and select FBS with lower autofluorescence.

  • Photobleaching and phototoxicity:

    • Problem: Repeated imaging leads to signal degradation and potential cellular damage.

    • Solution: Minimize exposure times; use sensitive cameras to reduce excitation intensity; consider interval imaging rather than continuous acquisition; use antifade reagents.

  • Threshold determination challenges:

    • Problem: Setting appropriate thresholds for distinguishing acidic from neutral pH signals is subjective and can affect results.

    • Solution: Use ratiometric calibration with ionophores to establish pH standards; develop automated thresholding algorithms; maintain consistent thresholding methodology across experiments.

  • Distinguishing lysophagy from MVB formation:

    • Problem: TMEM192-mKeima can detect signals from multivesicular body formation that may be confused with lysophagy.

    • Solution: Include controls with ESCRT machinery inhibition; use correlative light-electron microscopy for structural validation; combine with ubiquitin markers to confirm lysophagy specificity.

  • Lysosomal pH variations:

    • Problem: Treatment with certain compounds may alter lysosomal pH without inducing lysophagy, affecting mKeima signals.

    • Solution: Include parallel pH sensors like LysoTracker; validate with pH-independent lysophagy markers; control for pH effects with calibration curves.

  • Protein aggregation artifacts:

    • Problem: Overexpression of TMEM192-mKeima can lead to protein aggregation and false-positive signals.

    • Solution: Titrate expression levels; validate with endogenous markers; use pulse-chase approaches to confirm turnover rather than aggregation .

By anticipating and addressing these common challenges, researchers can obtain more reliable and reproducible results from TMEM192-based assays.

How should researchers design experiments to distinguish between different lysosomal damage response pathways?

To effectively distinguish between different lysosomal damage response pathways (lysophagy, ESCRT-mediated repair, and TFEB-mediated transcription), researchers should implement a multi-faceted experimental design:

This integrated approach allows researchers to clearly delineate between different lysosomal damage response pathways and understand their respective contributions and interactions in maintaining lysosomal homeostasis.

What emerging applications of TMEM192 are likely to advance our understanding of cellular biology?

Several emerging applications of TMEM192 show promise for advancing our understanding of cellular biology:

  • Spatial transcriptomics of lysophagy microenvironments:

    • Combining TMEM192-mKeima with proximity labeling technologies (BioID, APEX) to identify the local proteome and transcriptome around lysosomes undergoing lysophagy

    • This could reveal novel regulatory factors and signaling nodes specific to the lysophagy process

  • Single-cell lysophagy profiling:

    • Adapting TMEM192-mKeima for flow cytometry-based analysis to enable high-throughput screening of lysophagy efficiency at the single-cell level

    • This would allow correlation of lysophagy capacity with other cellular parameters like cell cycle stage, metabolic state, or differentiation status

  • In vivo lysophagy monitoring:

    • Developing transgenic animal models expressing TMEM192-mKeima to study lysophagy in intact tissues and disease models

    • This could illuminate tissue-specific differences in lysophagy efficiency and its relevance to organ-specific pathologies

  • Lysophagy-targeted therapeutics:

    • Using TMEM192-based screening platforms to identify compounds that selectively modulate lysophagy without affecting general autophagy

    • Such compounds could have therapeutic potential for lysosomal storage disorders, neurodegenerative diseases, and certain cancers

  • Integrated stress response connections:

    • Exploring how lysophagy interacts with other cellular stress response pathways like the unfolded protein response, integrated stress response, and DNA damage response

    • TMEM192-based approaches could help map these interconnections and their significance for cellular homeostasis

  • Evolutionary conservation studies:

    • Comparative analysis of TMEM192 function across species could reveal evolutionary adaptations in lysosomal quality control mechanisms

    • This may provide insight into species-specific vulnerabilities to lysosomal dysfunction

These emerging applications leverage the specificity of TMEM192-based approaches to address fundamental questions about lysosomal biology and its broader implications for cellular health and disease.

How might technological innovations enhance TMEM192-based research methods?

Several technological innovations are poised to significantly enhance TMEM192-based research methods:

  • Advanced fluorescent protein engineering:

    • Development of brighter, more photostable pH-sensitive fluorescent proteins to replace mKeima

    • Engineering spectrally distinct variants for multiplexed imaging with other cellular markers

    • Creating infrared-shifted versions for deeper tissue imaging in vivo

  • Super-resolution microscopy applications:

    • Adapting TMEM192-based probes for STORM, PALM, or expansion microscopy

    • This would enable nanoscale visualization of lysophagy events, revealing structural details of autophagosome-lysosome interactions

  • Optogenetic lysophagy induction systems:

    • Creating light-activatable versions of TMEM192 that can trigger localized lysosomal damage upon illumination

    • This would enable spatiotemporal control of lysophagy for studying local effects and propagation of responses

  • CRISPR-based endogenous tagging:

    • CRISPR knock-in of mKeima into the endogenous TMEM192 locus

    • This would eliminate artifacts from overexpression and ensure physiological regulation of the tagged protein

  • Artificial intelligence image analysis:

    • Machine learning algorithms for automated detection and classification of TMEM192-mKeima signals

    • Deep learning approaches to extract complex patterns from lysophagy dynamics data

  • Correlative light-electron microscopy (CLEM) workflows:

    • Specialized CLEM protocols for tracking TMEM192-mKeima-positive structures from fluorescence microscopy to electron microscopy

    • This would provide ultrastructural context for lysophagy events detected by fluorescence

  • High-content screening applications:

    • Automated, plate-based imaging systems for TMEM192-mKeima assays

    • This would enable genome-wide screens for lysophagy regulators and pharmacological modulators

  • Microfluidic "lysosome-on-a-chip" systems:

    • Integrating TMEM192-mKeima reporters with microfluidic technologies

    • This would allow precise control of the cellular microenvironment while monitoring lysophagy responses

These technological innovations promise to extend the capabilities of TMEM192-based research methods, enabling more precise, comprehensive, and physiologically relevant investigations of lysosomal biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.