Recombinant Pongo abelii Transmembrane protein 196 (TMEM196)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please indicate it in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please consult your local distributors for specific delivery information.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag during production.
Synonyms
TMEM196; Transmembrane protein 196
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM196
Target Protein Sequence
MCTSGQIIGSLLVLSVLEIGLGVSSVAVGAVSFSLALREHKPQLGDSSPFLLCGICGILC AKKKSGLVMILFSACCICGLIGGILNFQFLRAVTKKTSSLYPLHLASMSLACIGIGGCTL SSWLTCRLASYEQRRMFSEREHSLHHSHEMAEKRLRAIEITDLPSCPVVPPTPELPTRK
Uniprot No.

Target Background

Database Links

KEGG: pon:100172204

UniGene: Pab.8347

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the optimal protocol for reconstitution and storage of recombinant Pongo abelii TMEM196?

For optimal reconstitution of lyophilized Pongo abelii TMEM196:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

Storage recommendations:

  • Store at -20°C/-80°C upon receipt

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • For extended storage, maintain at -80°C in buffer containing 50% glycerol

The optimal storage buffer typically contains Tris-based buffer with 50% glycerol at pH optimized for the specific protein (typically pH 7.5-8.0) .

How can researchers effectively validate recombinant Pongo abelii TMEM196 activity in experimental systems?

Validating TMEM196 activity requires a multi-pronged approach:

  • Structural integrity assessment:

    • SDS-PAGE analysis to confirm protein purity (should exceed 90%)

    • Western blot detection using anti-TMEM196 antibodies

    • Circular dichroism to assess proper protein folding

  • Functional assays:

    • Wnt signaling reporter assays (since TMEM196 has been shown to inhibit Wnt signaling)

    • Cell proliferation assays (MTT or CCK-8) to measure growth inhibition effects

    • Flow cytometry to assess effects on cell cycle progression and apoptosis

  • Binding studies:

    • Co-immunoprecipitation to identify interaction partners

    • Surface plasmon resonance to measure binding kinetics with potential ligands

  • Cellular localization:

    • Immunofluorescence microscopy to confirm membrane localization

    • Subcellular fractionation followed by Western blot analysis

For maximal reliability, positive controls using human TMEM196 should be included, as the human variant has been more extensively characterized in functional studies .

What experimental approaches should be used to investigate TMEM196's role in cell proliferation?

Based on published research methodologies, the following experimental approaches are recommended:

  • Gain-of-function studies:

    • Stable transfection of TMEM196 in cell lines with low endogenous expression

    • Inducible expression systems to control timing and level of expression

    • Cell proliferation assays: Use CCK-8 or MTT assays over 1-5 days post-transfection

    • Colony formation assays: Seed transfected cells at low density and culture for 14-21 days

  • Loss-of-function studies:

    • siRNA or shRNA knockdown in cells with high TMEM196 expression

    • CRISPR/Cas9 gene editing to generate knockout models

    • Proliferation analysis: Published data shows ~30% enhanced growth following knockdown

    • Colony formation: ~60% increase in colony formation ability after TMEM196 knockdown

  • Cell cycle analysis:

    • Flow cytometry with propidium iodide staining

    • Western blot for cell cycle regulators (p21, cyclin D1)

    • Published data indicates TMEM196 overexpression increases G2/M phase arrest

  • Apoptosis assessment:

    • Annexin V-APC/7-AAD staining and flow cytometry

    • Western blot for apoptotic markers (Bax, cleaved caspase-3)

    • Reported apoptosis rates: 15.77±1.26% in TMEM196-transfected cells vs. 7.62±1.05% in controls

Experimental ApproachKey Findings from Published StudiesReference
Cell proliferation after TMEM196 knockdown~30% enhanced growth
Colony formation after TMEM196 knockdown~60% increase
Apoptosis rate with TMEM196 overexpression15.77±1.26% vs. 7.62±1.05% in controls
G2-phase cells with TMEM196 overexpression15.28±0.82% vs. 10.76±0.30% in controls

How does TMEM196 function in developmental processes and how can this be studied?

TMEM196 plays important roles in embryonic development, particularly in neural tube formation and floor plate determination . To study these functions:

  • Developmental model systems:

    • Chick embryo models - TMEM196 is expressed in the floor plate of the neural tube

    • Mouse embryonic stem cell (mESC) differentiation systems

    • Generation of TMEM196 mutant embryonic stem cell lines

  • Floor plate differentiation protocol:

    • Establish floor plate differentiation protocol using embryonic stem cells

    • Compare wild-type vs. TMEM196 knockout/knockdown cells

    • Analyze markers of floor plate determination

    • Assess cell proliferation during neural development

  • Wnt signaling analysis:

    • TMEM196 inhibits Wnt signaling during developmental processes

    • TOP/FOP flash reporter assays to quantify Wnt pathway activity

    • Analysis of downstream Wnt targets by qPCR and Western blot

    • Rescue experiments using Wnt activators in TMEM196-expressing cells

  • Cell fate determination assays:

    • Analysis of neuromesodermal cell fate decisions

    • TMEM196 mutant cells exhibit aberrant paraxial mesoderm differentiation

    • Immunostaining for lineage-specific markers

    • Transcriptome analysis to identify cell fate signatures

How does Pongo abelii TMEM196 compare structurally and functionally to its human ortholog?

The structural and functional comparison between Pongo abelii and human TMEM196 reveals important evolutionary insights:

  • Sequence homology:

    • Pongo abelii TMEM196 shares high sequence identity with human TMEM196

    • Both proteins maintain conserved transmembrane domains

    • Key functional residues involved in signaling are preserved

  • Expression patterns:

    • Both species show similar tissue expression profiles

    • Neural tissues and embryonic structures show highest expression

    • Developmental timing of expression appears conserved

  • Functional conservation:

    • Both proteins likely function in growth regulation and development

    • Wnt signaling inhibition appears to be a conserved function

    • Tumor suppressor properties are likely maintained across species

  • Methodological approach for comparative studies:

    • Heterologous expression of both orthologs in the same cellular background

    • Comparative functional assays measuring proliferation, migration, and signaling

    • Chimeric protein construction to identify functionally divergent domains

    • Cross-species rescue experiments in knockout models

This comparative approach can help identify evolutionarily conserved functional domains that may represent critical regions for therapeutic targeting in human disease contexts .

What is known about TMEM196 genetic variation among orangutan populations?

While specific data on TMEM196 variation among orangutan populations is limited, general patterns of genetic diversity in orangutans can inform our understanding:

  • Population genetic structure:

    • Sumatran orangutans (Pongo abelii) show higher genetic diversity than Bornean orangutans (Pongo pygmaeus)

    • Mean heterozygosity for Pongo abelii is 0.258 ± 0.02, significantly higher than Pongo pygmaeus (0.121 ± 0.02)

    • This pattern likely extends to TMEM196 locus variation

  • Implications for functional studies:

    • When using Pongo abelii TMEM196 as a model, researchers should consider potential population-specific variants

    • Sumatran orangutan TMEM196 may contain more allelic variation

    • Functional studies may need to account for this variation when extrapolating to other primates

  • Methodological approaches for genetic variation studies:

    • Targeted sequencing of TMEM196 across orangutan populations

    • Assessment of regulatory region variation affecting expression levels

    • Functional testing of prevalent variants to identify phenotypic effects

The higher genetic diversity in Sumatran orangutans suggests that Pongo abelii TMEM196 may contain variants with potentially diverse functional effects that could inform human TMEM196 research .

What is the significance of TMEM196 hypermethylation in cancer research and how can researchers investigate this mechanism?

TMEM196 hypermethylation has emerged as a significant epigenetic alteration in cancer, particularly lung cancer:

  • Methylation frequency and clinical significance:

    • TMEM196 is hypermethylated in 68.1% (64/94) of lung cancer tissues

    • 52.8% (67/127) of plasma and 55.2% (79/143) of sputum samples show methylation

    • Normal tissues (0/50) show no methylation

    • Associated with poor differentiation and advanced pathological stage

    • Patients with low TMEM196 expression show significantly poorer survival (HR = 3.007; 95%CI, 1.918-4.714)

  • Methodological approaches for methylation studies:

    • Methylation-specific PCR (MSP) for targeted analysis

    • Bisulfite genomic sequencing (BGS) for detailed methylation patterns

    • Treatment with 5-aza-2'-deoxycytidine (10 μM for 3 days) to reverse methylation

    • Real-time quantitative methylation PCR for quantitative assessment

  • Experimental design for functional validation:

    • Correlation of methylation status with protein expression using immunohistochemistry

    • Tissue microarrays for high-throughput analysis

    • Kaplan-Meier survival analysis stratified by TMEM196 expression

    • Multivariate Cox regression to establish independent prognostic value

Sample TypeTMEM196 Methylation FrequencyReference
Lung cancer tissues68.1% (64/94)
Plasma samples52.8% (67/127)
Sputum samples55.2% (79/143)
Normal tissues0% (0/50)

How can researchers effectively design experiments to investigate TMEM196's tumor suppressor properties?

To investigate TMEM196's tumor suppressor properties, researchers should consider the following comprehensive experimental approach:

  • In vitro functional studies:

    • Stable TMEM196 expression in cancer cell lines (with methylated/silenced endogenous TMEM196)

    • Cell viability assays: Documented 20-40% reduction in colony formation following TMEM196 expression

    • Migration assays: Wound healing assays show significantly decreased motility in TMEM196-expressing cells

    • Cell cycle analysis: G2/M arrest (15.28±0.82% vs. 10.76±0.30%) and decreased S-phase cells

    • Apoptosis assessment: 15.77±1.26% apoptotic cells in TMEM196 transfectants vs. 7.62±1.05% in controls

  • Molecular mechanism investigation:

    • Analyze downstream target genes by qPCR and Western blot

    • Key targets: upregulation of p21 and Bax; downregulation of cyclin D1, c-myc, CD44 and β-catenin

    • Pathway analysis using specific inhibitors/activators

    • Chromatin immunoprecipitation to identify direct transcriptional targets

  • In vivo tumor models:

    • Xenograft models in nude mice

    • Comparison of tumor size and weight between TMEM196-expressing and control cells

    • Immunohistochemical analysis of tumor tissues

    • Metastasis models to assess invasion properties

  • Clinical correlation studies:

    • Tissue microarray analysis of TMEM196 expression in tumor samples

    • Correlation with clinicopathological features

    • Survival analysis using Kaplan-Meier curves and Cox regression

    • Independent validation in multiple patient cohorts

This comprehensive approach has successfully demonstrated TMEM196's role as a functional tumor suppressor, with significant effects on multiple cancer hallmarks, including proliferation, apoptosis, and migration .

What are the challenges in expressing full-length recombinant TMEM196 in prokaryotic systems and how can they be addressed?

Expressing transmembrane proteins like TMEM196 in bacterial systems presents several challenges:

  • Common expression issues:

    • Protein misfolding and aggregation due to hydrophobic transmembrane domains

    • Toxicity to host cells when overexpressed

    • Lack of post-translational modifications found in eukaryotic systems

    • Low yield of functional protein

  • Optimized expression strategies:

    • Use of specialized E. coli strains (e.g., C41(DE3), C43(DE3)) designed for membrane protein expression

    • Lower induction temperature (16-25°C) to reduce aggregation

    • Reduced IPTG concentration (0.1-0.5 mM) for slower expression

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Use of solubility-enhancing tags (SUMO, MBP, TrxA) at the N-terminus

  • Purification considerations:

    • Careful selection of detergents (DDM, LDAO, or Fos-choline-12)

    • Two-step purification using affinity chromatography followed by size exclusion

    • Protein quality assessment via circular dichroism and thermal shift assays

    • Limited proteolysis to identify stable domains

  • Alternative expression systems:

    • Cell-free expression systems may be suitable for difficult membrane proteins

    • Eukaryotic expression in insect cells (baculovirus) or mammalian cells for proper folding

    • Yeast expression (Pichia pastoris) for higher yields of functional membrane proteins

When available, consider using the empirically determined conditions from successful expression of Pongo abelii TMEM196 in E. coli as reported in product information .

What controls and validation steps are critical when studying TMEM196 function in cellular models?

When investigating TMEM196 function, rigorous controls and validation steps are essential:

  • Expression validation:

    • Quantitative RT-PCR to confirm transcript levels

    • Western blot to verify protein expression

    • Immunofluorescence to confirm proper cellular localization

    • Multiple antibodies targeting different epitopes to ensure specificity

  • Functional controls:

    • Empty vector controls in overexpression studies

    • Non-targeting siRNA/shRNA in knockdown experiments

    • Rescue experiments to confirm phenotype specificity

    • Positive controls using known tumor suppressors (e.g., p53, PTEN)

  • Experimental design considerations:

    • Multiple cell lines to ensure phenotypic consistency

    • Time-course experiments to capture dynamic effects

    • Dose-dependent experiments with inducible systems

    • Independent replication of key findings (minimum triplicate experiments)

  • Methodological validation:

    • Multiple independent clones/transductants to rule out integration effects

    • Multiple siRNA/shRNA sequences to minimize off-target effects

    • Complementary approaches (e.g., CRISPR knockout + siRNA knockdown)

    • Independent assays measuring the same biological endpoint

  • Data analysis and reporting:

    • Appropriate statistical tests with correction for multiple comparisons

    • Blinded analysis when possible

    • Complete reporting of all experimental conditions

    • Clear documentation of antibody validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.