Recombinant Pongo abelii Transmembrane protein 199 (TMEM199)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM199; Transmembrane protein 199
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM199
Target Protein Sequence
MASSLLAGERLVRALGPGGELEPELLPRKLRAELEAALGKKHTGGDSSSGPQRLVSFRLI RDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITR NVTCQDTRHGGTLSDLGKQVRSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEMASRVL AALIVASVVGLAELYVMVRAMEGELGEL
Uniprot No.

Target Background

Function
TMEM199 plays a crucial role in intracellular iron homeostasis under aerobic conditions. It triggers the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, leading to HIF1A hydroxylation and subsequent proteasomal degradation. Additionally, it is essential for endolysosomal acidification and lysosomal degradation and may participate in Golgi homeostasis.
Database Links
Subcellular Location
Cytoplasmic vesicle, COPI-coated vesicle membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How does TMEM199 contribute to V-ATPase assembly and function?

TMEM199 plays a critical role in V-ATPase complex assembly and function:

  • Assembly Factor Role:

    • TMEM199 functions as a V-ATPase assembly factor, similar to its yeast homolog Vma12p/Vph2p

    • Genetic disruption of TMEM199 impairs V-ATPase assembly and function

  • Endolysosomal Function:

    • TMEM199 is required for endolysosomal acidification

    • It facilitates lysosomal degradation processes

  • Impact on Iron Metabolism:

    • V-ATPase disruption through TMEM199 knockout results in intracellular iron depletion

    • This iron depletion impairs prolyl hydroxylase domain (PHD) enzyme activity, leading to HIF1α stabilization

    • Iron supplementation can directly restore PHD catalytic activity following V-ATPase inhibition

  • Lysosomal Quantity Regulation:

    • TMEM199 knockdown significantly decreases lysosome quantity

    • This affects protein degradation pathways, including those for PD-L1, EGFR, and HLA proteins

  • What is known about TMEM199-congenital disorder of glycosylation (TMEM199-CDG)?

TMEM199-CDG is a rare autosomal recessive inherited disease with characteristic features:

  • Clinical Presentation:

    • Chronically elevated serum transaminases (ALT: 23-437 IU/L; AST: 31-746 IU/L)

    • Decreased serum ceruloplasmin (0.03-0.24 g/L) and serum copper (2.80-8.60 μmol/L)

    • Elevated alkaline phosphatase (132-3990 IU/L)

    • Hypercholesterolemia (total: 5.3-9.3 mmol/L; LDL: 1.16-7.17 mmol/L)

    • Steatosis and/or fibrosis on liver biopsy

  • Epidemiology:

    • Only eight patients reported worldwide (seven Europeans, one Chinese)

    • Age range: 2-41 years

    • Male predominance (six male, two female patients)

  • Genetic Basis:

    • Mutations in the TMEM199 gene

    • Novel frameshift variant reported: c.128delA/p.Lys43Argfs*25

  • Laboratory Diagnosis:

    • Reduced TMEM199 protein expression by immunohistochemistry

    • Abnormal protein glycosylation pattern consistent with type II CDG

    • Liver ultrastructure showing dilation and vesiculation of the Golgi and/or endoplasmic reticulum

  • Treatment and Prognosis:

    • Limited treatment options with no definitive effect: bicyclic alcohol, zinc sulfate, penicillamine

    • Variable disease progression; some patients show no deterioration over decades

    • Cirrhosis detected in a Chinese patient suggests potentially unfavorable outcomes in some cases

  • How does nuclear TMEM199 regulate immune response in cancer?

Recent research has revealed TMEM199 has important nuclear functions in immune regulation:

  • Nuclear Localization and Function:

    • TMEM199 is detected in the nucleus of multiple cancer cell lines

    • It functions as a transcriptional co-factor regulating immune checkpoint genes

  • PD-L1 Regulation Mechanism:

    • Nuclear TMEM199 binds to gene promoter sites of multiple factors that regulate PD-L1:

      • IFNGR1

      • IRF1

      • MTMR9

      • KAT8

      • Trim28

    • This binding induces PD-L1 mRNA expression, promoting immune escape

  • Impact on Tumor Microenvironment:

    • TMEM199 knockdown reduces tumor size in xenograft models

    • TMEM199-depleted tumors show increased CD8+ and CD11b+ immune cell infiltration

    • CD4+ cells are decreased in TMEM199 knockdown xenografts

  • Gene Expression Changes:

    • RNA-seq analysis of TMEM199 knockdown cells reveals enrichment in immune response and tumor necrosis factor-mediated signaling pathway genes

  • What methodological approaches are used to study TMEM199's role in HIF1α regulation?

Multiple methodologies have been employed to elucidate TMEM199's role in HIF1α regulation:

  • Genetic Screening:

    • Unbiased genome-wide genetic screen in near-haploid human cells identified TMEM199 as a regulator of HIF1α

    • CRISPR-Cas9 targeting of TMEM199 followed by FACS sorting for reporter activation

  • HIF1α Assessment:

    • Reporter systems using GFP to measure HIF1α stabilization

    • Immunoblotting to confirm endogenous HIF1α accumulation in TMEM199-depleted cells

  • Validation Approaches:

    • Rescue experiments with CRISPR-resistant TMEM199 expression

    • Generation of TMEM199 knockout clones to confirm HIF1α accumulation

    • Reconstitution experiments in clonal cells to reverse HIF1α accumulation

  • Mechanistic Studies:

    • Iron supplementation experiments to determine the link between V-ATPase, iron metabolism, and HIF1α regulation

    • Analysis of prolyl hydroxylase (PHD) activity following V-ATPase inhibition

  • What are the emerging therapeutic approaches targeting TMEM199?

Research suggests potential therapeutic applications related to TMEM199:

  • Proton Pump Inhibitor Effects:

    • The proton pump inhibitor (PPI) omeprazole significantly decreases TMEM199 protein levels

    • Correspondingly, CD274 (PD-L1) mRNA is largely decreased by omeprazole treatment

  • Implications for Immunotherapy:

    • TMEM199 is identified as a targetable immune regulator

    • PPI application disrupts immune therapy in clinical settings

    • Research is ongoing to elucidate TMEM199's role in influencing PPI immunotherapy efficacy

  • Potential Therapeutic Targets:

    • Nuclear TMEM199 function as a transcriptional regulator offers novel targeting opportunities

    • Modulation of TMEM199 expression could potentially enhance immune cell infiltration in tumors

    • Alternative approaches to target downstream effectors in TMEM199-regulated pathways

  • Considerations for TMEM199-CDG:

    • No definitive treatments exist for TMEM199-CDG

    • Current approaches (vitamin D, penicillamine, bicyclic alcohol, zinc sulfate) show limited effectiveness

    • Development of targeted therapies for this rare disorder remains an unmet need

  • How do experimental conditions affect recombinant TMEM199 expression and purification?

Optimizing experimental conditions is critical for successful work with recombinant TMEM199:

  • Expression Systems:

    • E. coli remains the primary expression system for recombinant Pongo abelii TMEM199

    • Expression construct design typically includes N-terminal His-tagging for purification

  • Purification Strategies:

    • Denaturing conditions may be necessary for initial purification:

      • Denaturing lysis buffer (50 mM Tris-HCl pH 8, 500 mM NaCl, 8 M urea, 20 mM imidazole)

      • Gradual removal of urea during column washing to promote proper refolding

    • Nickel-nitrilotriacetic acid-agarose affinity chromatography is the standard purification method

  • Protein Stability Considerations:

    • Addition of cryoprotectants (glycerol, trehalose) is essential for maintaining protein stability

    • Protein concentration is typically maintained at 0.1-1.0 mg/mL

    • pH optimization around 8.0 appears optimal for recombinant TMEM199

  • Quality Control Measures:

    • SDS-PAGE for purity assessment (>90% standard)

    • Mass spectrometry for sequence verification

    • Functional assays to confirm biological activity

  • What analytical techniques are used to study TMEM199 interactions with binding partners?

Multiple advanced analytical techniques are employed to characterize TMEM199 protein-protein interactions:

  • Co-Immunoprecipitation with Mass Spectrometry (Co-IP/MS):

    • TMEM199 interacting proteins (TIPs) are pulled down using anti-TMEM199 antibodies

    • Mass spectrometry identifies binding partners

    • Gene Ontology-Cellular Component (GOCC) analysis reveals functional localization patterns

  • Cut&Tag Assay:

    • Used to globally analyze TMEM199-bound gene sites

    • Identified binding to promoters of IFNGR1, IRF1, MTMR9, KAT8, and Trim28

  • Direct Interaction Studies:

    • Examination of potential direct interactions with proteins like PD-L1

    • Western blot analysis following immunoprecipitation

  • Peptide Binding Assays:

    • Synthetic peptide fragments for mapping interaction domains

    • HPLC and MALDI-TOF-MS for characterization

    • Acetylation and amidation modifications to stabilize peptides for interaction studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.