Recombinant Pongo abelii Transmembrane protein 205 (TMEM205)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

TMEM205 is a 189-amino-acid transmembrane protein encoded by the TMEM205 gene (UniProt ID: Q5REM8). The recombinant form is expressed in E. coli with an N-terminal His tag for purification and stability . Key characteristics include:

PropertyValue
SpeciesPongo abelii (Sumatran orangutan)
Protein LengthFull-length (1–189 amino acids)
Molecular Weight~21.2 kDa
TagN-terminal His tag ; tag type may vary during production
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0 ; Tris-based buffer + 50% glycerol
StabilityStore at -20°C/-80°C; avoid repeated freeze-thaw cycles

Platinum Drug Resistance

TMEM205 is implicated in resistance to platinum-based chemotherapeutics (e.g., cisplatin, oxaliplatin) in cancer cells. Studies using recombinant hTMEM205 in E. coli revealed:

  • Mechanism: Selective extrusion of cisplatin and oxaliplatin via a sulfur-based translocation mechanism, excluding carboplatin .

  • Evidence: Pt quantification in E. coli showed reduced intracellular drug accumulation in hTMEM205-expressing cells .

DrugExtrusion by TMEM205MechanismReference
CisplatinYesSulfur-mediated export
OxaliplatinYesSulfur-mediated export
CarboplatinNoNot recognized

Tissue Expression

Recombinant TMEM205 studies align with endogenous expression patterns:

  • High Expression: Observed in secretory tissues (thyroid, adrenal gland, pancreas, mammary glands) and platinum-resistant tumors .

Applications in Research

Recombinant TMEM205 is used in:

  • SDS-PAGE: For purity assessment and structural validation .

  • ELISA: As a reference antigen in immunoassays (e.g., 50 µg vials available) .

  • Functional Assays: To study Pt drug resistance mechanisms in E. coli and mammalian models .

Clinical Relevance

TMEM205 overexpression correlates with:

  • Cancer Drug Resistance: Enhanced in cisplatin-resistant tumors .

  • Inflammatory Diseases: Linked to thyroiditis and prostatitis .

Handling and Stability

ParameterRecommendation
ReconstitutionDeionized water (0.1–1.0 mg/mL) + 5–50% glycerol
Storage-20°C/-80°C (long-term); 4°C (short-term)
Freeze-ThawAvoid repeated cycles

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
TMEM205; Transmembrane protein 205
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM205
Target Protein Sequence
MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI SMGCAFVNLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTV EKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLA GLALEIRSL
Uniprot No.

Target Background

Database Links
Protein Families
TMEM205 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM205 and what is its basic cellular function?

TMEM205 is a transmembrane protein originally identified as a hypothetical membrane protein with unclear function. Research has now established that it is localized at the cell surface and plays a critical role in cellular extrusion mechanisms for certain compounds, particularly platinum-based chemotherapeutic agents . The protein appears to be involved in membrane transport processes that can impact intracellular accumulation of specific compounds.

How conserved is TMEM205 between humans and non-human primates such as Pongo abelii?

While the provided search results do not specifically address the conservation of TMEM205 between humans and orangutans, transmembrane proteins often show significant evolutionary conservation, particularly in functional domains. Researchers working with recombinant Pongo abelii TMEM205 should consider performing sequence alignment analyses to identify conserved regions that may maintain similar functional properties to the human variant.

Conservation analysis between human and orangutan TMEM205 would be particularly important when designing experiments to extrapolate findings across species. Functional domains involved in platinum compound recognition and export mechanisms identified in human TMEM205 should be examined for conservation in the Pongo abelii variant to predict functional similarities .

How does TMEM205 contribute to cisplatin resistance in cancer cells?

TMEM205 has been demonstrated to play a direct role in cisplatin resistance through several mechanisms. Most significantly, it mediates the selective export of platinum-based drugs, specifically cisplatin and oxaliplatin (but interestingly not carboplatin), thereby reducing intracellular accumulation of these chemotherapeutic agents . This export function represents a pre-target resistance mechanism that prevents platinum compounds from reaching their cellular targets.

Research has shown that TMEM205 is overexpressed in cisplatin-resistant cancer cell lines, with functional studies confirming reduced accumulation of fluorescence-labeled cisplatin in cells with elevated TMEM205 expression . The molecular mechanism involves a putative sulfur-based translocation process by which TMEM205 recognizes platinum compounds and facilitates their extrusion from cells . This process directly contributes to reduced intracellular platinum concentrations, allowing cancer cells to evade cisplatin-induced cytotoxicity.

What is the prognostic significance of TMEM205 expression in hepatocellular carcinoma?

Multivariate Cox regression analysis, controlling for potential confounding clinical factors including age, gender, pathologic stage, pathologic T stage, and pathologic grade, confirmed that low TMEM205 expression independently predicted poor DSS (p=0.002) and poor OS (p=0.032) . This seemingly paradoxical relationship between TMEM205 expression and prognosis may be explained by the protein's interactions with the tumor immune microenvironment rather than just its role in drug resistance.

How does TMEM205 influence the tumor immune microenvironment?

TMEM205 expression appears to have significant associations with the composition and function of immune cells within the tumor microenvironment. Research has identified a positive correlation between TMEM205 expression and the proportion of macrophages in tumor tissues (Pearson r=0.45, p<0.0001) . This relationship may be mechanistically important as a low proportion of macrophages has been independently associated with poor disease-specific survival in HCC patients.

Further analyses revealed that TMEM205 expression is negatively correlated with markers of immunosuppressive cells, including M2 macrophage markers (CD163, EGR2, and MS4A4A) and expression of CSF1 and CSF1R, which are involved in the polarization of monocytes to M2-like macrophages . TMEM205 expression also shows negative correlations with Treg markers and chemokine receptors responsible for Treg migration to the tumor microenvironment . These findings suggest that TMEM205 may exert antitumor effects by inhibiting M2 macrophage polarization, reducing Treg recruitment, and facilitating CD8+ T cell infiltration into tumor tissues.

What expression systems are optimal for producing recombinant TMEM205?

For producing recombinant TMEM205, including the Pongo abelii variant, bacterial expression systems such as E. coli have been successfully employed. Research has demonstrated the feasibility of a low-cost and high-throughput recombinant expression platform for studying TMEM205 . This approach allows for the functional characterization of the protein's role in platinum drug resistance.

When designing an expression system for recombinant TMEM205, researchers should consider that as a transmembrane protein, proper folding and membrane insertion are critical for maintaining function. The methods described in the literature include quantitative analysis of the effects of platinum coordination complexes on cellular growth and filamentation in E. coli cells expressing human TMEM205 . Similar approaches could be adapted for expressing recombinant Pongo abelii TMEM205, with appropriate modifications to account for potential differences in codon usage and protein folding requirements.

How can researchers effectively measure TMEM205 expression levels in experimental samples?

For quantitative analysis of TMEM205 expression levels, real-time PCR (RT-PCR) has been successfully employed. The methodology involves RNA extraction followed by cDNA synthesis and amplification using TaqMan Gene Expression Assays and Universal PCR Master Mix Reagents . The PCR protocol includes pre-incubation at 50°C for 2 minutes, incubation at 95°C for 10 minutes, and amplification by 40 cycles at 95°C for 15 seconds and 60°C for 1 minute .

For protein-level detection, immunoblotting with TMEM205-specific antibodies has been used. Additionally, confocal microscopy and immuno-electron microscopy have been employed to determine subcellular localization of TMEM205 . When standardizing these methods for recombinant Pongo abelii TMEM205, researchers should validate antibody cross-reactivity with the orangutan variant or develop specific antibodies if necessary.

What functional assays can assess TMEM205-mediated cisplatin resistance?

Several functional assays have been developed to measure TMEM205's impact on cisplatin resistance. One approach involves quantifying intracellular platinum accumulation in control versus TMEM205-expressing cells using platinum quantification methods . Reduced accumulation of fluorescence-labeled cisplatin has been detected in TMEM205-transfected stable clones, providing a measurable phenotype .

Another functional assay is based on the original observation by the Rosenberg group, which led to the discovery of cisplatin. This involves quantitative analysis of the effects of platinum coordination complexes on cellular growth and filamentation in E. coli cells expressing TMEM205 . Researchers can couple these growth assays with platinum quantification to establish a mechanistic link between TMEM205 expression and cisplatin resistance.

For studying recombinant Pongo abelii TMEM205, these assays could be adapted by introducing the orangutan TMEM205 variant into appropriate cellular models and comparing functional outcomes with those observed for human TMEM205.

How can mutation analysis of TMEM205 reveal insights into its mechanism of action?

Mutation analysis of TMEM205 has proven valuable for elucidating the protein's mechanism of action, particularly regarding its selectivity for certain platinum compounds. Research has revealed that TMEM205 recognizes and exports cisplatin and oxaliplatin but not carboplatin, suggesting specific molecular recognition mechanisms . By conducting systematic mutation analysis of key residues, researchers have identified a putative sulfur-based translocation mechanism involved in platinum compound extrusion .

For researchers working with recombinant Pongo abelii TMEM205, comparative mutation analysis between human and orangutan variants could provide insights into evolutionary conservation of functional domains. This approach might identify species-specific differences in substrate specificity or transport efficiency. Mutations should target conserved residues predicted to be involved in the recognition and transport of platinum compounds, with functional outcomes assessed using the experimental assays described earlier.

What role does TMEM205 nuclear translocation play in cancer cell resistance mechanisms?

Recent findings indicate that TMEM205 undergoes nuclear translocation in cisplatin-resistant cells , suggesting additional mechanisms beyond membrane transport by which this protein may influence drug resistance. This nuclear localization represents an important avenue for advanced research, as it could indicate previously uncharacterized functions such as transcriptional regulation or interaction with nuclear proteins involved in DNA damage response pathways.

For researchers investigating nuclear translocation of TMEM205, including the Pongo abelii variant, subcellular fractionation followed by immunoblotting would be an appropriate methodology to quantify nuclear versus cytoplasmic distribution. Immunofluorescence microscopy with antibodies specific to TMEM205 could provide visual confirmation of nuclear localization. To understand the functional significance of nuclear translocation, chromatin immunoprecipitation (ChIP) assays could identify potential TMEM205 interactions with DNA or chromatin-associated proteins.

How does TMEM205 influence cancer cell stemness and epithelial-mesenchymal transition?

Beyond its role in drug resistance, TMEM205 has been implicated in promoting proliferation, stemness, epithelial-mesenchymal transition (EMT), migration, and angiogenesis in gastric cancer cells . These findings suggest broader oncogenic functions that may contribute to aggressive cancer phenotypes independently of chemoresistance mechanisms.

For researchers investigating these aspects of TMEM205 function, appropriate methodologies would include:

  • Stemness assessment through sphere formation assays and expression analysis of stemness markers

  • EMT evaluation through morphological assessment and expression analysis of epithelial markers (E-cadherin) versus mesenchymal markers (N-cadherin, Vimentin)

  • Migration capabilities measured through wound healing or transwell migration assays

  • Angiogenic potential assessed through endothelial tube formation assays with conditioned media from TMEM205-expressing cells

When applying these methodologies to study recombinant Pongo abelii TMEM205, researchers should consider comparative analyses between human and orangutan variants to identify conserved and divergent functions related to cancer progression phenotypes.

Can TMEM205 be targeted to overcome cisplatin resistance in cancer therapy?

The identification of TMEM205 as a mediator of cisplatin resistance suggests its potential as a therapeutic target for overcoming chemoresistance. Research has explicitly stated that "hTMEM205 represents a new potential target that can be exploited to reduce cellular resistance towards Pt(II)-drugs" . Development of small molecule inhibitors or antibodies that block TMEM205's platinum export function could potentially resensitize resistant tumor cells to cisplatin therapy.

For researchers interested in therapeutic development, initial approaches might include high-throughput screening of compound libraries to identify molecules that bind to TMEM205 and inhibit its transport function. Structure-based drug design would require detailed structural information about TMEM205, which might be obtained through techniques such as cryo-electron microscopy or X-ray crystallography. Recombinant Pongo abelii TMEM205 could serve as an alternative structural model if it proves more amenable to crystallization than the human variant.

How might TMEM205 be utilized in immunotherapeutic approaches for cancer treatment?

Given TMEM205's associations with the tumor immune microenvironment, particularly its negative correlations with immunosuppressive cell markers, it presents interesting possibilities for immunotherapeutic applications. Research has shown that TMEM205 expression is negatively correlated with M2 macrophage markers and regulatory T cell (Treg) markers, while being positively correlated with CD8+ T cell infiltration .

These findings suggest that enhancing TMEM205 expression or function could potentially create a more favorable immune microenvironment by reducing immunosuppressive cells and promoting cytotoxic T cell infiltration. For researchers exploring this avenue, combination approaches that pair TMEM205-targeting strategies with existing immunotherapies might be particularly promising. As noted in the literature, "TMEM205 may be useful as part of combination therapy regimens" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.