Recombinant Pongo abelii Transmembrane protein 234 (TMEM234)

What is the basic structure of Pongo abelii TMEM234?

Pongo abelii Transmembrane protein 234 (TMEM234) is a 166-amino acid protein with transmembrane domains. The protein's amino acid sequence is: MAASLGQVLALVLVAALWGGTQPLLKRASAALQRVREPTWVRQLLQEMQTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITSSWQVPWTAELQLHGKGQLQTLSQKCKREASGAQSERFG . The protein has been computationally modeled using AlphaFold, producing a structure with a global pLDDT (predicted Local Distance Difference Test) score of 85.68, indicating a confident prediction . This protein's structure contains characteristic transmembrane helices that are typical of membrane transport proteins, consistent with its classification in transport-related protein families.

How is TMEM234 classified in protein databases?

TMEM234 is cataloged in several major protein databases. In UniProt, it is identified by the accession number Q5RBQ9 . In the Transporter Classification Database (TCDB), TMEM234 is classified under family #2.A.7.32, which places it within the larger superfamily of porters (uniporters, symporters, antiporters) . Additionally, TMEM234 contains a corresponding "TMEM234" Pfam domain that belongs to the "DMT" (Drug/Metabolite Transporter) clan of Pfam domains . It is also indexed in the Harmonizome database, which collects processed datasets about genes and proteins . These classifications collectively suggest TMEM234 functions as a transmembrane transport protein.

What are the recommended handling protocols for recombinant TMEM234?

For optimal handling of recombinant Pongo abelii TMEM234, researchers should store the protein at -20°C for regular use, or at -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles . It is critical to avoid repeated freezing and thawing as this can lead to protein degradation and loss of functional activity . The recombinant protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability . For experimental use, researchers should prepare small aliquots upon initial thawing to prevent repeated freeze-thaw cycles. When designing experiments, consider that the tag type on commercial recombinant proteins may vary depending on the production process, which could affect certain assays or applications.

What experimental approaches are suitable for studying TMEM234's potential transport function?

To investigate TMEM234's transport function, researchers should consider a multi-faceted approach:

• Vesicle-based transport assays: Reconstitute purified TMEM234 into liposomes loaded with potential substrate candidates and measure substrate accumulation or efflux.

• Cell-based uptake studies: Express TMEM234 in cell lines with low endogenous transporter activity (such as Xenopus oocytes or HEK293 cells) and measure uptake of radiolabeled or fluorescently labeled potential substrates.

• Electrophysiological techniques: If TMEM234 transport is electrogenic, patch-clamp recordings could detect substrate-induced currents.

• Site-directed mutagenesis: Based on the AlphaFold structural model (pLDDT score: 85.68) , identify and mutate key residues predicted to be involved in substrate binding or translocation to validate functional mechanisms.

• Cross-linking studies: Use chemical cross-linkers to identify protein-substrate interactions and potential binding sites.

These approaches should be complementary, as each provides different insights into transport function, kinetics, and substrate specificity.

How can researchers validate the AlphaFold predicted structure of TMEM234?

The AlphaFold computed structure model of TMEM234 (AF_AFQ5RBQ9F1) provides a starting point for structural studies, but requires experimental validation . Researchers should consider these complementary approaches:

• X-ray crystallography or cryo-EM: Though challenging for membrane proteins, these methods provide high-resolution structural data that can confirm or refine the predicted model.

• Circular dichroism (CD) spectroscopy: To verify secondary structure elements predicted in the model, particularly the α-helical content typical of transmembrane domains.

• Limited proteolysis combined with mass spectrometry: To identify accessible regions and validate domain boundaries.

• Cross-linking mass spectrometry (XL-MS): To validate predicted proximity relationships between amino acid residues.

• Cysteine scanning mutagenesis: Introduce cysteine residues at predicted water-accessible or lipid-exposed positions based on the model, then test accessibility with sulfhydryl reagents.

• Functional validation: Test whether mutations of residues predicted to be functional by the model affect protein activity in transport assays.

How can TMEM234's potential role as a solute carrier be experimentally verified?

Verifying TMEM234's function as a solute carrier requires rigorous experimental evidence beyond sequence-based classification. Implement this comprehensive workflow:

• Substrate screening: Develop a high-throughput screening system using TMEM234-expressing cells or proteoliposomes to test diverse compound libraries, including metabolites, ions, drugs, and signaling molecules. Focus on compounds transported by other members of the DMT clan.

• Transport kinetics characterization: For identified substrates, determine key transport parameters including Km, Vmax, and transport stoichiometry. Compare concentration-dependent uptake under various ion gradients to determine if transport is coupled to ion movement (symport/antiport mechanisms).

• Energetic mechanism determination: Systematically manipulate membrane potential and ion gradients to determine if transport is driven by electrochemical potential, consistent with secondary active transport typical of SLC-like proteins.

• Inhibitor profiling: Test known inhibitors of related transporters to develop a pharmacological profile and confirm the transport mechanism.

• Structural validation: Using the AlphaFold model (pLDDT: 85.68) as a starting point, identify potential substrate binding sites and validate through site-directed mutagenesis followed by transport assays.

• Physiological relevance: Investigate TMEM234 expression patterns across tissues and subcellular localizations to provide context for the identified transport function.

This systematic approach produces multiple lines of evidence required to definitively classify TMEM234 as a functional solute carrier.

What are the challenges in distinguishing TMEM234 from other solute carrier-like proteins?

Distinguishing TMEM234 from other solute carrier-like proteins presents several complex challenges for researchers:

Researchers must therefore combine computational predictions with rigorous experimental characterization to definitively place TMEM234 within the transporter landscape.

How might TMEM234 function differ between Pongo abelii and human orthologs?

Investigating functional differences between Pongo abelii TMEM234 and its human ortholog requires comparative evolutionary and functional analyses:

• Sequence conservation analysis: Perform detailed sequence alignments to identify conserved and divergent residues between Pongo abelii and human TMEM234. Focus particularly on transmembrane domains and potential substrate binding sites predicted from the AlphaFold model .

• Structural comparison: Compare the computational models of both orthologs to identify structural differences that might impact substrate binding pockets or transport pathways. Even subtle differences in key residues can significantly alter substrate specificity or transport kinetics.

• Expression pattern differences: Investigate whether expression patterns differ between species across tissues and developmental stages, which might indicate specialized functions.

• Functional comparative studies: Express both orthologs in identical cellular systems and compare transport activities for the same substrate panel. Measure kinetic parameters (Km, Vmax) and inhibitor sensitivities to quantify functional differences.

• Genetic context analysis: Examine whether genomic context (neighboring genes, regulatory elements) differs between species, potentially indicating divergent regulation or function.

• Co-evolution with substrates: Consider whether metabolic differences between humans and orangutans might drive functional specialization of TMEM234 to transport species-specific substrates.

Such comparative analysis not only illuminates evolutionary adaptation but could also provide insights into human-specific transport mechanisms relevant to drug development and disease understanding.

What are the common challenges in expressing and purifying recombinant TMEM234?

Expressing and purifying transmembrane proteins like TMEM234 presents several technical challenges that researchers should anticipate:

• Expression system selection: Mammalian expression systems often yield properly folded membrane proteins but with lower yields. Consider testing multiple systems including insect cells (Sf9, High Five), yeast (Pichia pastoris), and bacterial systems with specialized strains designed for membrane protein expression.

• Protein toxicity: Overexpression of transmembrane proteins can disrupt host cell membrane integrity. Utilize inducible expression systems and optimize induction conditions (temperature, inducer concentration, duration) to balance protein yield with host cell viability.

• Proper membrane insertion: TMEM234 requires proper insertion into membranes for folding. Consider using fusion partners (such as GFP) that can report on proper folding and membrane localization.

• Detergent selection: The choice of detergent for solubilization is critical. Screen multiple detergents (ranging from harsh ionic detergents to milder non-ionic or zwitterionic options) for their ability to extract TMEM234 while maintaining its native conformation.

• Protein stability: Once extracted from membranes, TMEM234 may show limited stability. Incorporate stabilizing additives (glycerol, specific lipids, cholesterol) in purification buffers and perform stability screens to identify optimal conditions.

• Purification strategy: Consider affinity tags that can be cleaved post-purification, as tags may interfere with function. Multi-step purification protocols combining affinity chromatography with size exclusion chromatography often yield higher purity.

• Reconstitution into lipid environments: For functional studies, reconstitution into liposomes or nanodiscs may be necessary. Optimize lipid composition to match the native environment of TMEM234.

Careful optimization of these parameters will significantly improve the yield and quality of purified TMEM234 for structural and functional studies.

How can researchers troubleshoot inconsistent results in TMEM234 functional assays?

When facing inconsistent results in TMEM234 functional assays, implement this systematic troubleshooting approach:

• Protein quality assessment:

  • Verify protein integrity using SDS-PAGE and Western blotting before each assay

  • Confirm proper folding using circular dichroism or intrinsic fluorescence

  • Check for aggregation using dynamic light scattering or size exclusion chromatography

• Assay condition optimization:

  • Systematically vary buffer components (pH, ionic strength, divalent cations)

  • Test multiple temperatures to find the optimal activity range

  • Evaluate the effect of lipid composition in reconstituted systems

• Technical variables control:

  • Standardize protein:lipid ratios in reconstitution experiments

  • Ensure consistent orientation in membrane systems (use orientation-specific markers)

  • Verify equal protein loading across experiments with quantitative methods

• Experimental design improvements:

  • Include positive controls using well-characterized transporters in parallel

  • Perform time-course experiments to identify optimal measurement windows

  • Use multiple detection methods to cross-validate transport activity

• Data analysis refinement:

  • Apply appropriate background subtraction methods

  • Evaluate data using multiple kinetic models

  • Implement statistical approaches to identify outliers

• Sample handling standardization:

  • Minimize freeze-thaw cycles as TMEM234 should not undergo repeated freezing and thawing

  • Maintain consistent sample handling times

  • Prepare fresh working solutions for critical components

Document all variables systematically to identify patterns in inconsistent results, which may themselves reveal important properties of TMEM234 function.

How should researchers interpret structure-function relationships in TMEM234?

Interpreting structure-function relationships in TMEM234 requires integrating computational predictions with experimental data:

Remember that structure-function interpretations remain hypothetical until validated experimentally through targeted mutations and functional assays.

What bioinformatic approaches are most valuable for predicting TMEM234 substrates?

Predicting potential substrates for TMEM234 requires sophisticated bioinformatic approaches that leverage multiple sources of information:

• Family-based substrate inference: As TMEM234 belongs to the TCDB #2.A.7.32 family and contains a DMT clan domain , analyze the known substrates of related transporters within these classifications. Create a database of substrates transported by proteins with similar domain architecture.

• Binding site analysis: Using the AlphaFold model (pLDDT: 85.68) :

  • Identify cavities and pockets using tools like CASTp or POCASA

  • Characterize the physicochemical properties of these pockets (hydrophobicity, charge, size)

  • Compare with known substrate binding sites in related transporters

• Molecular docking simulations: Perform virtual screening of metabolite libraries against predicted binding sites, ranking compounds by binding energy and interaction patterns.

• Evolutionary coupling analysis: Identify co-evolving residues using methods like EVcouplings or DCA (Direct Coupling Analysis), which often reveal residues that interact with substrates.

• Expression correlation mining: Analyze transcriptomic datasets to identify metabolic genes whose expression patterns correlate with TMEM234, suggesting functional relationships.

• Machine learning approaches:

  • Train models on known transporter-substrate pairs using physicochemical descriptors

  • Apply transfer learning from related transporter families

  • Implement graph neural networks to capture structural relationships

• Phylogenetic profiling: Compare the phylogenetic distribution of TMEM234 with metabolic enzymes across species, as co-occurrence often indicates functional relationships.

These computational predictions should be organized into a ranked list of candidate substrates for subsequent experimental validation, prioritizing those identified by multiple independent methods.

How can TMEM234 research contribute to comparative primate biology?

Research on Pongo abelii TMEM234 offers unique opportunities to advance comparative primate biology through multiple avenues:

• Metabolic adaptation insights: As a potential solute carrier within the DMT clan , TMEM234 might transport metabolites essential for specific adaptations in orangutan physiology. Comparing transport kinetics and substrate preferences between orangutan TMEM234 and orthologs from other primates could reveal species-specific metabolic adaptations.

• Evolutionary rate analysis: By comparing sequence conservation patterns of TMEM234 across primates, researchers can determine if this transporter experienced accelerated evolution in certain lineages, suggesting functional divergence potentially related to dietary specialization or habitat adaptation.

• Regulatory evolution: Examining expression patterns of TMEM234 across tissues in different primates could reveal regulatory changes that contributed to physiological differences between species, particularly in metabolically active tissues like liver or brain.

• Structural comparative biology: The AlphaFold model of Pongo abelii TMEM234 (pLDDT: 85.68) provides a foundation for comparing structural features with human and other primate orthologs, potentially revealing species-specific substrate binding site adaptations.

• Transport-related disease model development: Understanding functional differences between human and orangutan TMEM234 could provide insights into human-specific transport-related disorders, establishing Pongo abelii as a comparative model for human disease.

• Conservation implications: Characterizing the role of TMEM234 in orangutan physiology might reveal metabolic vulnerabilities relevant to conservation efforts for this endangered species, particularly regarding dietary requirements or environmental adaptations.

These research directions collectively contribute to understanding primate evolutionary biology through the lens of membrane transport physiology.

What potential roles might TMEM234 play in cellular homeostasis?

Based on its classification and structural features, TMEM234 may contribute to cellular homeostasis through several potential mechanisms:

• Metabolite transport: As a member of the DMT clan of transporters , TMEM234 likely mediates the movement of specific metabolites across cellular membranes. This function could be critical for:

  • Supplying substrates for essential metabolic pathways

  • Removing toxic metabolic byproducts

  • Regulating intracellular concentrations of signaling molecules

• pH regulation: Many solute carriers couple substrate transport to proton movement. If TMEM234 functions as a proton-coupled transporter, it may contribute to intracellular or organellar pH homeostasis.

• Nutrient sensing: Transporters often function as nutrient sensors that trigger signaling cascades in response to substrate availability. TMEM234 could potentially serve as a metabolic sensor that regulates cellular responses to nutrient fluctuations.

• Organellar function: The subcellular localization of TMEM234 (which remains to be experimentally determined) would significantly impact its homeostatic role. If localized to specific organelles, it might contribute to compartment-specific metabolite regulation.

• Redox balance: If TMEM234 transports redox-active compounds, it could influence cellular redox state and oxidative stress responses.

• Ion homeostasis: Some members of the DMT clan transport ions or couple metabolite transport to ion movement, suggesting TMEM234 might contribute to cellular ion balance.

These potential roles highlight the importance of determining TMEM234's substrate specificity, transport mechanism, and subcellular localization to understand its precise contribution to cellular homeostasis.

How does TMEM234 compare with other proteins in the DMT clan?

TMEM234 shares several features with other members of the Drug/Metabolite Transporter (DMT) clan while maintaining distinct characteristics:

The DMT clan encompasses diverse transporters including nucleotide-sugar transporters, tripartite tricarboxylate transporters, and drug exporters. While TMEM234's precise position within this diversity remains to be experimentally validated, its classification in TCDB family #2.A.7.32 suggests functional similarity to other secondary active transporters in the DMT clan .

What can be inferred about TMEM234 evolution based on available data?

Several evolutionary insights about TMEM234 can be inferred from available data:

• Conservation across primates: The presence of TMEM234 in both Pongo abelii (Sumatran orangutan) and humans suggests conservation of this gene across diverse primate lineages, indicating its functional importance throughout primate evolution.

• Membership in ancient protein families: TMEM234's classification in the DMT clan of Pfam domains and TCDB family #2.A.7.32 places it within evolutionarily ancient transporter families. The DMT clan likely originated early in cellular evolution, as transporters are essential for cellular compartmentalization.

• Structural conservation: The AlphaFold model (pLDDT: 85.68) suggests TMEM234 adopts the characteristic alpha-helical bundle fold typical of membrane transporters, reflecting evolutionary conservation of this structural architecture despite sequence divergence.

• Functional constraint: The confident structural prediction (pLDDT: 85.68) suggests evolutionary constraints on sequence variation to maintain structural integrity, typical of proteins with essential functions.

• Potential evolutionary selection: If TMEM234 functions as a solute carrier as suggested by its classification , it may have experienced lineage-specific selection pressures related to metabolic adaptations in different primate species, particularly if it transports diet-derived compounds.

• Domain architecture stability: The presence of a specific TMEM234 Pfam domain suggests a stable evolutionary history for this protein, maintaining its core functional architecture while potentially allowing for substrate specificity adaptations.

Further phylogenetic analyses across broader taxonomic groups would provide additional insights into TMEM234's evolutionary history and potential functional diversification.

What are the highest priority research questions regarding TMEM234?

Based on current knowledge gaps, these research questions represent the highest priorities for advancing TMEM234 understanding:

• Substrate identification: What is the primary physiological substrate (or substrates) of TMEM234? This fundamental question underlies all functional characterization and should be addressed through systematic transport assays with diverse candidate compounds.

• Transport mechanism characterization: Does TMEM234 function as a uniporter, symporter, or antiporter? Is transport coupled to ion gradients (H+, Na+)? Understanding the energetic basis of transport will clarify its classification as an SLC-like protein.

• Structural validation: How accurate is the AlphaFold predicted structure (pLDDT: 85.68) , and what conformational changes occur during the transport cycle? Experimental structure determination would significantly advance mechanistic understanding.

• Physiological role: What is the biological function of TMEM234 in cellular and organismal physiology? Knockout/knockdown studies combined with metabolomic analyses could reveal its role in metabolic pathways.

• Expression and localization patterns: Where is TMEM234 expressed at the tissue and subcellular levels? Immunohistochemistry and subcellular fractionation studies would clarify its physiological context.

• Regulation mechanisms: How is TMEM234 expression and activity regulated in response to physiological stimuli? Transcriptional, post-translational, and acute regulatory mechanisms should be investigated.

• Comparative function: Do the human and Pongo abelii orthologs of TMEM234 differ in substrate specificity, transport kinetics, or regulation? Comparative studies could reveal species-specific adaptations.

• Disease relevance: Is TMEM234 dysfunction associated with any disease states? Genetic association studies and mechanistic investigations in disease models could reveal potential clinical relevance.

Addressing these questions through coordinated experimental approaches would significantly advance our understanding of this potential solute carrier protein.

What methodological innovations might accelerate TMEM234 research?

Accelerating TMEM234 research requires innovative methodological approaches that overcome current technical limitations:

• Microfluidic transport assays: Developing microfluidic platforms for high-throughput screening of potential TMEM234 substrates would dramatically increase the efficiency of substrate identification, allowing simultaneous testing of hundreds of compounds under various conditions.

• Nanobody-enabled structural studies: Generating stabilizing nanobodies against TMEM234 could facilitate structural studies by stabilizing specific conformational states, improving prospects for crystallization or high-resolution cryo-EM imaging.

• Single-molecule transport visualization: Adapting single-molecule fluorescence techniques to visualize individual transport events would provide unprecedented insights into TMEM234 transport kinetics and conformational dynamics.

• CRISPR-based functional genomics: Implementing genome-wide CRISPR screens in cellular models with TMEM234-dependent phenotypes could identify interaction partners and regulatory pathways.

• Computational substrate prediction: Developing machine learning algorithms trained on known transporter-substrate pairs could generate prioritized candidate substrate lists for experimental validation.

• Native mass spectrometry approaches: Adapting native MS techniques for membrane proteins would enable identification of endogenous ligands and study of protein-ligand interactions without requiring prior knowledge of substrates.

• Organoid-based functional studies: Implementing TMEM234 functional studies in tissue-specific organoids would provide more physiologically relevant insights into its role in cellular metabolism.

• Multimodal in silico screening: Combining multiple computational approaches (docking, molecular dynamics, binding site analysis) into integrated workflows could improve the accuracy of substrate predictions.

• Isotope tracing coupled with metabolomics: Developing sensitive metabolomic approaches to track isotope-labeled potential substrates would help identify genuine transport substrates versus secondary metabolic effects.