Recombinant Pongo abelii Transmembrane protein 246 (TMEM246)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PGAP4; TMEM246; Post-GPI attachment to proteins factor 4; Post-GPI attachment to proteins GalNAc transferase 4; Transmembrane protein 246
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM246
Target Protein Sequence
MSTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQEFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAVPEEQIFPVLEHLLRARFSEPHLRDA LYLKLYHPERLQHYTNPEPMRILEWVGVGMLLGPLLTWIYMRFASRPGFSWPVMLFFSLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL
Uniprot No.

Target Background

Function
TMEM246 is a Golgi-resident glycosylphosphatidylinositol (GPI)-N-acetylgalactosamine transferase involved in GPI-anchor maturation. Specifically, it participates in lipid remodeling, generating two saturated fatty chains at the sn-2 position of GPI-anchored proteins. It is essential for the initial step of GPI-GalNAc biosynthesis, transferring GalNAc to GPI in the Golgi following fatty acid remodeling by PGAP2.
Database Links

KEGG: pon:100173151

UniGene: Pab.11513

Protein Families
TMEM246 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How evolutionarily conserved is TMEM246 across primate species?

TMEM246 is highly conserved across primate species, with significant sequence homology observed between Pongo abelii (Sumatran orangutan) and human TMEM246. The high conservation suggests important functional roles that have been maintained throughout primate evolution . Like other transmembrane adaptor proteins (TRAPs), certain domains and motifs are likely to be particularly well conserved, especially those involved in critical protein-protein interactions . The orangutan version has the UniProt ID Q5R868, which can be used for comparative sequence analyses with human and other primate homologs .

What are the known functions of TMEM246 in cellular processes?

While specific functions of Pongo abelii TMEM246 remain under investigation, its synonyms (PGAP4, Post-GPI attachment to proteins factor 4, Post-GPI attachment to proteins GalNAc transferase 4) suggest involvement in post-translational modification of GPI-anchored proteins . Based on structural features common to transmembrane adaptor proteins, TMEM246 may participate in organizing signaling complexes at the plasma membrane, serving as a scaffold for the assembly of signaling molecules . Expression correlation data suggests potential functional associations with genes involved in development (e.g., gata5) and cellular signaling pathways, with a negative correlation to ribosomal proteins, suggesting possible inverse relationship with protein synthesis pathways .

What expression systems are optimal for producing recombinant Pongo abelii TMEM246?

For recombinant Pongo abelii TMEM246 production, E. coli expression systems have been successfully employed . The methodology involves:

  • Cloning the full-length sequence (1-403 aa) into an appropriate expression vector

  • Adding an N-terminal His-tag for purification purposes

  • Transforming into an E. coli strain optimized for protein expression

  • Inducing expression under controlled conditions

  • Harvesting and lysing bacteria

  • Purifying using affinity chromatography

For researchers requiring mammalian post-translational modifications, alternative expression in mammalian cell lines may be considered, though this would require protocol optimization. When selecting an expression system, consider the downstream applications of the protein and whether proper folding and post-translational modifications are critical for your studies .

What are the recommended purification and storage protocols for recombinant TMEM246?

The optimal purification and storage protocol for recombinant Pongo abelii TMEM246 includes:

Purification:

  • Affinity chromatography using His-tag binding resins

  • Buffer exchange to Tris-based buffer

  • Optional secondary purification steps (e.g., size exclusion chromatography)

  • Quality control by SDS-PAGE (expected purity >90%)

Storage:

  • Store the lyophilized powder at -20°C/-80°C for long-term storage

  • For working solutions, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for cryoprotection

  • Aliquot to avoid repeated freeze-thaw cycles

  • For short-term use (up to one week), store working aliquots at 4°C

After reconstitution, the protein should be maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Avoid repeated freeze-thaw cycles as this can lead to protein degradation and loss of functional activity.

What functional assays can be used to study TMEM246 activity?

Based on the potential functions of TMEM246 as a GPI protein modification enzyme (PGAP4), several assays can be employed:

  • GalNAc transferase activity assays:

    • Using fluorescently labeled substrates to detect glycosyltransferase activity

    • Mass spectrometry to identify GPI-anchor modifications

  • Membrane localization studies:

    • Fluorescent protein tagging combined with confocal microscopy

    • Subcellular fractionation followed by Western blotting

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with potential binding partners

    • Proximity ligation assays to detect in situ interactions

    • Yeast two-hybrid screening to identify novel interaction partners

  • Functional knockout/knockdown studies:

    • CRISPR-Cas9 mediated knockout followed by phenotypic analysis

    • RNA interference to assess effects of reduced expression on cellular processes

These assays should be optimized based on the specific research question and experimental system being used .

How does Pongo abelii TMEM246 compare structurally and functionally to its human homolog?

A comparative analysis between Pongo abelii and human TMEM246 would involve:

The homology between human and orangutan TMEM246 suggests conserved functions, but specific amino acid differences might confer species-specific interactions or regulatory mechanisms . Analysis of translocon-mediated membrane integration efficiency between species could provide insights into evolutionary adaptations of membrane protein folding and stability .

What can gene expression correlation data tell us about the functional network of TMEM246?

Gene expression correlation analysis provides valuable insights into the potential functional networks of TMEM246. The correlation data shows:

Positively Correlated Genesr ValueNegatively Correlated Genesr Value
zgc:1100450.201rpl36-0.068
crygm2f0.184rps21-0.063
taar19i0.184rpl38-0.060
gata50.181si:dkey-151g10.6-0.058
LOC1018840450.167rps27a-0.052

This data suggests TMEM246 expression positively correlates with developmental regulators like gata5 (r=0.181) and negatively correlates with ribosomal proteins .

To interpret this correlation network:

  • Pathway enrichment analysis: Determine if correlated genes cluster in specific biological pathways

  • Temporal co-expression patterns: Analyze if the correlations persist across different developmental stages

  • Regulatory elements analysis: Identify shared transcription factor binding sites

  • Functional validation: Experimentally test if manipulation of TMEM246 expression affects levels of correlated genes

The negative correlation with ribosomal proteins suggests a potential inverse relationship with general protein synthesis machinery, which could indicate specialized roles in cellular states where protein synthesis is selectively regulated .

How can TMEM246 be studied in the context of pluripotent stem cell models?

TMEM246 can be effectively studied in pluripotent stem cell models using several approaches:

  • Expression profiling during differentiation:

    • Monitor TMEM246 expression across differentiation stages

    • Correlate expression patterns with developmental markers

    • Compare expression levels between naive and primed pluripotent states

  • Functional studies in iPSCs:

    • Generate TMEM246 knockout/knockdown in Pongo abelii iPSCs

    • Assess effects on pluripotency maintenance and differentiation capacity

    • Evaluate impact on cell signaling pathways

  • Comparative species analysis:

    • Compare TMEM246 expression and function between human and orangutan iPSCs

    • Study evolutionary conservation of regulatory mechanisms

    • Identify species-specific functions

Recent advances in generating induced pluripotent stem cells from Bornean orangutans (bo-iPSCs) provide excellent model systems for such studies . The established protocols using Sendai virus-mediated Yamanaka factor reprogramming of peripheral blood mononuclear cells can be applied, with subsequent culture in appropriate media such as Essential 8 Flex Medium on Matrigel matrix .

What are the predicted membrane integration dynamics of TMEM246 and how might they affect protein function?

The membrane integration dynamics of transmembrane proteins like TMEM246 can be analyzed using computational approaches:

Computational analyses similar to those performed for G-protein coupled receptors reveal that membrane integration efficiency can significantly impact protein folding, stability, and ultimately function . Experimental validation of these predictions using techniques like glycosylation mapping or cysteine accessibility can provide insights into the actual topology of TMEM246 in cellular membranes.

How might structural studies of TMEM246 inform drug development targeting transmembrane signaling pathways?

Structural studies of TMEM246 can contribute to drug development in several ways:

  • Identification of druggable pockets and domains:

    • High-resolution structural data can reveal potential binding sites

    • Computational docking studies can identify candidate molecules

    • Structure-based design can guide development of specific inhibitors or activators

  • Understanding transmembrane signaling mechanisms:

    • Elucidating how conformational changes propagate across the membrane

    • Identifying critical residues for signal transduction

    • Mapping interaction surfaces with binding partners

  • Comparative structural biology approach:

    • Analyze structural differences between human and orangutan TMEM246

    • Identify conserved structural features as potential therapeutic targets

    • Leverage evolutionary conservation data to predict functional importance

  • Application to related proteins:

    • Use structural insights from TMEM246 to understand related transmembrane adaptor proteins

    • Develop inhibitors that specifically target disease-relevant TRAP family members

    • Create structurally-informed therapeutic strategies for disorders involving membrane protein dysfunction

Advanced structural studies (X-ray crystallography, cryo-EM, or NMR spectroscopy) combined with molecular dynamics simulations can provide crucial insights into the conformational dynamics of TMEM246, potentially revealing novel intervention points for therapeutic development .

What are common challenges in expressing and purifying transmembrane proteins like TMEM246?

Researchers frequently encounter several challenges when working with transmembrane proteins like TMEM246:

  • Expression challenges:

    • Low expression yields due to toxicity to host cells

    • Protein misfolding and aggregation

    • Inclusion body formation in bacterial systems

    Solution approaches:

    • Optimize codon usage for expression host

    • Use tightly controlled inducible promoters

    • Lower expression temperature (16-20°C)

    • Try fusion partners that enhance solubility (MBP, SUMO, etc.)

  • Purification challenges:

    • Detergent selection for membrane extraction

    • Protein instability during purification

    • Low purity due to copurification of membrane-associated proteins

    Solution approaches:

    • Screen multiple detergents (DDM, LDAO, etc.)

    • Include stabilizing agents (glycerol, specific lipids)

    • Perform two-step purification (affinity followed by size exclusion)

    • Add protease inhibitors to prevent degradation

  • Storage stability:

    • Aggregation during freeze-thaw

    • Loss of activity over time

    Solution approaches:

    • Add cryoprotectants like trehalose (6%) and glycerol (50%)

    • Store at optimal pH (8.0 for TMEM246)

    • Create small aliquots to avoid repeated freeze-thaw cycles

For TMEM246 specifically, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with addition of 50% glycerol has been reported as effective for long-term storage at -20°C/-80°C .

How can researchers effectively analyze the membrane topology of TMEM246?

Determining the correct membrane topology of TMEM246 requires a multi-method approach:

  • Computational prediction methods:

    • Use algorithms like TMHMM, Phobius, or TOPCONS to predict transmembrane regions

    • Apply the "positive-inside rule" to predict orientation

    • Compare predictions across multiple algorithms for consensus

  • Experimental topology mapping:

    • Glycosylation mapping: Introduce N-glycosylation sites at various positions and analyze which sites become glycosylated (indicates luminal/extracellular location)

    • Protease protection assays: Determine which regions are protected from proteolytic digestion

    • Cysteine scanning mutagenesis: Introduce cysteines and test accessibility to membrane-impermeant labeling reagents

    • Fluorescence protease protection (FPP): Use GFP fusions and proteases to determine orientation

  • Validation approaches:

    • Antibody accessibility in intact versus permeabilized cells

    • FRET-based distance measurements

    • Crosslinking studies with interacting partners of known orientation

By combining these approaches, researchers can generate a reliable topological model of TMEM246, which is essential for understanding its function and interactions with binding partners .

What is the potential role of TMEM246 in comparative primate genomics and evolutionary studies?

TMEM246 offers several promising avenues for evolutionary and comparative genomics research:

  • Evolutionary rate analysis:

    • Compare substitution rates across primate lineages

    • Identify sites under positive or purifying selection

    • Correlate evolutionary patterns with functional domains

  • Comparative expression studies:

    • Analyze tissue-specific expression patterns across primates

    • Identify species-specific regulatory elements

    • Correlate expression differences with species-specific traits

  • Structural adaptation analysis:

    • Compare membrane integration efficiency between species

    • Identify adaptive changes in transmembrane domains

    • Model the functional consequences of species-specific substitutions

  • Applications in primate conservation genomics:

    • Use as a marker for genetic diversity studies in endangered primates

    • Include in genomic resource development for conservation initiatives

    • Study in the context of creating conservation-relevant iPSC lines

The generation of induced pluripotent stem cells from both Sumatran (Pongo abelii) and Bornean orangutans (Pongo pygmaeus) provides valuable research platforms for comparative studies that can inform both evolutionary biology and conservation efforts . These cellular models allow functional testing of evolutionary hypotheses regarding transmembrane protein adaptations across primate lineages.

How might TMEM246 research contribute to understanding membrane protein folding disorders?

Research on TMEM246 can provide insights into membrane protein folding mechanisms and associated disorders:

  • Membrane protein quality control mechanisms:

    • Investigate factors affecting successful membrane integration

    • Study degradation pathways for misfolded transmembrane proteins

    • Identify quality control checkpoints specific to multi-pass membrane proteins

  • Disease relevance:

    • Explore how mutations in transmembrane domains affect protein stability

    • Model how folding defects lead to cellular dysfunction

    • Develop strategies to rescue misfolded membrane proteins

  • Therapeutic approaches:

    • Screen for pharmacological chaperones that stabilize membrane proteins

    • Identify small molecules that modulate membrane integration efficiency

    • Develop targeted approaches to enhance membrane protein folding

The analysis of translocon-mediated membrane integration, similar to studies with G-protein coupled receptors, could provide a framework for understanding how sequence variations impact the fidelity of membrane protein folding . This knowledge could potentially be applied to numerous diseases caused by membrane protein misfolding, including cystic fibrosis, retinitis pigmentosa, and certain neurodegenerative disorders.

What bioinformatic approaches are most effective for predicting functional interactions of TMEM246?

Several bioinformatic approaches can effectively predict functional interactions of TMEM246:

  • Sequence-based methods:

    • Profile Hidden Markov Models to identify distant homologs

    • Motif scanning to identify functional elements

    • Coevolution analysis to identify physically interacting residues

  • Network-based predictions:

    • Gene co-expression network analysis

    • Protein-protein interaction database mining

    • Pathway enrichment analysis

  • Integrated approaches:

    • Machine learning models incorporating multiple data types

    • Bayesian integration of diverse functional genomics datasets

    • Text mining of scientific literature

  • Structural bioinformatics:

    • Homology modeling to predict 3D structure

    • Molecular docking to identify potential binding partners

    • Molecular dynamics simulations to assess interaction stability

The gene correlation data showing associations between TMEM246 and genes like zgc:110045 (r=0.201), crygm2f (r=0.184), and gata5 (r=0.181) provides a foundation for network-based analyses . Researchers should integrate these correlation patterns with other data types, including protein-protein interaction databases, phylogenetic profiles, and functional annotations to build comprehensive predictive models of TMEM246 function in cellular pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.