Recombinant Pongo abelii Transmembrane protein 41B (TMEM41B)

Shipped with Ice Packs
In Stock

Description

Biological Functions

TMEM41B is implicated in several cellular processes:

Autophagy and Lipid Mobilization

  • Role in Autophagosome Formation: TMEM41B facilitates ER membrane remodeling and autophagosome sealing by acting as a lipid scramblase. Knockout (KO) cells accumulate immature autophagosomes and enlarged lipid droplets (LDs) .

  • Interaction with Lipid Metabolism: TMEM41B regulates LD dynamics and lipid transfer at ER-LD contact sites. Depletion disrupts lipid homeostasis, affecting cholesterol and phosphatidylserine distribution .

Viral Replication

  • Host Factor for Viruses: TMEM41B is essential for the replication of coronaviruses, flaviviruses, and pseudorabies virus (PRV). It supports viral replication organelle formation (e.g., double-membrane vesicles) and lipid redistribution .

  • Interferon-Stimulated Gene (ISG): TMEM41B is induced by interferon (IFN), enhancing PRV entry by modulating clathrin-coated pit dynamics via lipid synthesis .

Embryogenesis

TMEM41B and its paralog VMP1 are critical for primitive lipoprotein biogenesis and early embryonic lineage specification. Double KO in mice causes embryonic lethality by embryonic day 7.5 (E7.5) .

Mechanistic Insights

StudyFindingsReferences
Autophagy RegulationTMEM41B KO cells show defective autophagosome maturation and LD accumulation.
Lipid Scrambling ActivityTMEM41B remodels ER membranes via lipid scrambling, enabling autophagosome expansion.
Viral ReplicationTMEM41B knockdown inhibits PRV entry by blocking lipid-dependent clathrin-coated pit dynamics.
Developmental RoleTMEM41B/VMP1 double KO disrupts embryogenesis by impairing lipoprotein synthesis.

Interaction Partners

  • VMP1: Cooperates with TMEM41B in ER membrane remodeling and lipid scrambling .

  • SIGMAR1: A TMEM41B interactor involved in ER-mitochondria lipid/calcium exchange .

  • AP2B1: TMEM41B regulates AP2B1 dynamics during clathrin-mediated endocytosis .

Applications and Implications

  • Therapeutic Target: TMEM41B inhibition could suppress viral infections (e.g., SARS-CoV-2, PRV) by disrupting replication organelles .

  • Disease Models: TMEM41B mutations are linked to neurodegenerative disorders (e.g., ALS) via disrupted ER-mitochondria crosstalk .

Technical Considerations

  • Storage: Recombinant TMEM41B is stable at -20°C/-80°C but degrades with repeated freeze-thaw cycles .

  • Purity: >90% purity confirmed by SDS-PAGE .

Future Directions

  • Elucidate structural details of TMEM41B’s lipid scramblase activity.

  • Develop small-molecule inhibitors targeting TMEM41B for antiviral therapies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
TMEM41B; Transmembrane protein 41B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM41B
Target Protein Sequence
MAKGRVAERSQMGADHTTPVGDGAAGTRGPAAPGSRDYQKEKSWAEAGSARMSLLILVSI FLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFAT YIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLT EKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP SFVAIKAGTTLHQPTTAGEAVSWNSIFILMILAVLSILPAIFQKKLKQKFE
Uniprot No.

Target Background

Function
TMEM41B is a phospholipid scramblase integral to lipid homeostasis and membrane dynamics. It exhibits scramblase activity toward cholesterol, phosphatidylserine, phosphatidylethanolamine, and phosphatidylcholine. Crucially, it's involved in autophagosome formation, participating in early biogenesis at the endoplasmic reticulum (ER) membrane. This function involves re-equilibrating ER leaflets as lipids are extracted by ATG2 (ATG2A or ATG2B) for autophagosome assembly. Beyond autophagy, TMEM41B's phospholipid scramblase activity is essential for other cellular processes, and it's required for normal motor neuron development.
Database Links
Protein Families
TMEM41 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endomembrane system.

Q&A

What is TMEM41B and what is its cellular function?

TMEM41B is a multipass transmembrane protein containing a VTT domain (named based on homology among VMP1, TMEM41A/B, and TMEM64) . It functions primarily in membrane remodeling processes, particularly in early stages of autophagy. TMEM41B physically interacts with VMP1, as demonstrated through in vitro binding assays where both proteins co-distribute as a single peak during size-exclusion chromatography . The interaction appears to involve multiple TMEM41B molecules associating with each VMP1 molecule, suggesting a complex quaternary structure . Additionally, TMEM41B has been identified in multiple genome-wide CRISPR-Cas9 screens as playing an important role in autophagy pathway regulation .

How many isoforms of human TMEM41B exist and how do they differ functionally?

There are four reported isoforms of human TMEM41B, with significant functional differences:

IsoformVTT Domain StatusFlavivirus SupportNotable Features
Isoform 1Fully intactComplete supportFirst ~47 amino acids unstructured
Isoform 1 (N-term truncated)IntactComplete supportLacks first 47 amino acids
Isoform 4Partial (50%)Partial supportOnly partially supports YFV infection
Isoforms 2 & 3IncompleteNo supportCannot support flavivirus infection

Research demonstrates that only isoforms containing the complete VTT domain can fully support flavivirus infection in TMEM41B knockout cells, indicating this domain is critical for TMEM41B's viral host factor function .

What expression systems are optimal for producing functional recombinant TMEM41B?

Multiple expression systems have been utilized for TMEM41B production, each with distinct advantages:

Expression SystemAdvantagesApplicationsNotes
E. coliHigh yield, cost-effectiveStructural studies, antibody productionMay require optimization for membrane protein folding
YeastBetter post-translational modificationsFunctional studiesIntermediate between prokaryotic and mammalian systems
BaculovirusHigher eukaryotic modificationsProtein-protein interaction studiesSuitable for larger-scale production
Mammalian cellsNative-like modificationsFunctional assays, virus interaction studiesLower yield but most physiologically relevant

For functional studies investigating viral interactions, mammalian or insect expression systems are preferred to ensure proper folding and post-translational modifications of this complex transmembrane protein .

What are the recommended methods for reconstituting lyophilized TMEM41B protein?

For optimal reconstitution of lyophilized TMEM41B, briefly centrifuge the vial before opening to ensure contents are at the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add glycerol to a final concentration of 5-50% (50% is standard) and aliquot before storing at -20°C/-80°C to avoid repeated freeze-thaw cycles . This methodology preserves protein structure and function while preventing aggregation during storage.

How does TMEM41B function as a pan-flavivirus host factor?

TMEM41B serves as a critical host factor for the entire Flaviviridae family through several mechanisms:

  • Membrane Remodeling: TMEM41B is recruited to flavivirus RNA replication complexes to facilitate membrane curvature, creating protected environments for viral genome replication .

  • Replication Complex Formation: Loss of TMEM41B significantly reduces viral RNA replication, indicating its essential role in establishing functional replication machinery .

  • Immune Evasion: TMEM41B absence leads to increased innate immune activation in response to flavivirus infection, suggesting it may help flaviviruses evade immune detection .

Experimental evidence shows TMEM41B knockout cells exhibit profound resistance to flavivirus infection, with viral replication severely impaired across multiple cell types including human and mosquito cells .

Beyond flaviviruses, what other viral families require TMEM41B for infection?

TMEM41B exhibits selective requirements across viral families:

Viral FamilyRequirement for TMEM41BRepresentative VirusNotes
FlaviviridaeRequiredYFV, ZIKV, DENV-2, WNVUniversal requirement across family
CoronaviridaeRequiredSARS-CoV-2Significant impairment in absence of TMEM41B
PicornaviridaeRestrictingCoxsackievirus B3Enhanced infection in TMEM41B knockout cells
Other RNA virus familiesNot requiredVariousNo significant effect observed
DNA virusesNot requiredVariousNo significant effect observed

This selective requirement pattern suggests TMEM41B's role in specific membrane remodeling processes that are exploited differently by various virus families .

How does TMEM41B contribute to autophagy initiation?

TMEM41B functions at the early stage of autophagy, working in concert with VMP1. Genome-wide CRISPR-Cas9 screens designed to identify novel autophagy genes consistently identify TMEM41B as essential . Its precise mechanism involves:

  • Direct interaction with VMP1, as confirmed through co-immunoprecipitation and in vitro binding assays .

  • Facilitation of membrane curvature necessary for autophagosome formation.

  • Potential role in lipid mobilization, similar to its functional partner VMP1, which is known to participate in lipid dynamics and autophagy .

Importantly, while canonical autophagy may not be required for flavivirus replication, TMEM41B appears to bridge non-canonical autophagy mechanisms with viral replication complex formation .

What methods are most effective for studying TMEM41B's role in autophagy?

TechniqueApplicationAdvantagesMethodological Notes
GFP-LC3-RFP reporterAutophagic flux monitoringReal-time visualizationUsed in genome-wide screens that identified TMEM41B
CRISPR-Cas9 knockoutLoss-of-function analysisComplete protein removalGenerated in multiple cell types to confirm phenotypes
Reconstitution assaysStructure-function studiesIdentifies critical domainsShown that VTT domain is essential for function
Co-IP and in vitro bindingProtein-protein interactionsDirect interaction evidenceRevealed TMEM41B-VMP1 stoichiometry
Electron microscopyUltrastructural analysisVisualizes membrane changesCan observe autophagosome formation defects

The combined approach of these methods provides complementary insights into TMEM41B's functional role in the autophagy pathway.

How functionally conserved is TMEM41B across species?

Functional conservation testing reveals interesting patterns:

SpeciesOrtholog Function in Human CellsAlignment with Human TMEM41BNotes
HumanBaseline reference100%Fully supports flavivirus infection
Mosquito speciesPartially functionalExtensive amino acid differencesMay affect interaction with human VMP1
Tick speciesLess functionalFurther evolutionary divergenceLess compatible with human cellular machinery
Pongo abeliiHighly functionalHigh similarityOrangutan TMEM41B closely resembles human version

Experiments show that evolutionarily divergent TMEM41B orthologs exhibit reduced capacity to support flavivirus infection in human cells, likely due to impaired interaction with human VMP1 .

How can single nucleotide polymorphisms (SNPs) in TMEM41B be analyzed for their impact on flavivirus susceptibility?

SNPs in TMEM41B have significant implications for flavivirus susceptibility, particularly those present at nearly 20% frequency in East Asian populations . Methodological approaches include:

  • CRISPR-mediated homology-directed repair to introduce specific SNPs into cell lines.

  • Viral infection assays comparing wild-type versus SNP-containing cells using standardized viral stocks and multiplicity of infection.

  • Analysis of viral replication kinetics through qRT-PCR, plaque assays, and immunofluorescence to quantify differences.

  • Structure-function studies to determine how specific SNPs affect TMEM41B's interaction with VMP1 and recruitment to viral replication complexes.

  • Population genetics approaches to correlate SNP frequency with regional patterns of flavivirus disease prevalence.

These techniques can reveal mechanisms by which natural genetic variation in TMEM41B influences population-level susceptibility to flavivirus infections .

What are the methodological approaches for studying TMEM41B's membrane remodeling capacity?

TechniquePurposeMethodological DetailsResearch Applications
Liposome deformation assaysAssess membrane curvature capacityRecombinant TMEM41B incubated with fluorescently labeled liposomesQuantifies intrinsic membrane-bending activity
Electron microscopyVisualize membrane structuresFixed cells examined for ultrastructural changesDirectly observes membrane morphology alterations
FRET-based proximity assaysMeasure protein-lipid interactionsLabeled TMEM41B and lipid sensorsDetermines lipid preference and binding dynamics
Reconstitution in giant unilamellar vesiclesFunctional reconstructionPurified protein incorporated into artificial membranesMinimal system to assess sufficiency for membrane remodeling
Live-cell imaging with tagged TMEM41BDynamics in living cellsFluorescent protein-tagged TMEM41BVisualizes recruitment to replication complexes

These complementary approaches can elucidate how TMEM41B facilitates the membrane remodeling essential for both autophagy and viral replication complex formation .

What methodologies can be employed to target TMEM41B for antiviral drug development?

Given TMEM41B's role as a pan-flavivirus host factor, it represents a promising therapeutic target. Research methodologies include:

  • High-throughput screening approaches using TMEM41B knockout and reconstituted cell lines to identify compounds that specifically disrupt TMEM41B function.

  • Structure-based drug design targeting the VTT domain, which is essential for flavivirus replication support .

  • Peptide inhibitor development focused on disrupting TMEM41B-VMP1 interaction, though accessibility challenges exist for targeting transmembrane protein interfaces .

  • PROTAC (Proteolysis Targeting Chimera) approach to selectively degrade TMEM41B in infected cells.

  • Rational design of membrane-permeable peptides similar to approaches used for NOX2, though with specificity for TMEM41B interfaces .

The challenge remains developing specific inhibitors that disrupt viral replication without significantly impairing normal cellular functions, particularly autophagy .

How can divergent requirements for TMEM41B between different viral families be exploited for broad-spectrum antiviral development?

The observation that TMEM41B is required for both Flaviviridae and SARS-CoV-2 but restricts Coxsackievirus B3 presents unique research opportunities :

  • Comparative viral replication complex analysis between flaviviruses and coronaviruses to identify common TMEM41B-dependent mechanisms.

  • Domain mapping studies to identify regions of TMEM41B differentially required by different virus families.

  • Time-of-addition experiments with TMEM41B inhibitors to determine critical windows in viral life cycles.

  • Proteomic analysis of TMEM41B interaction partners during infection by different viruses.

  • Development of modulators that selectively enhance TMEM41B's restrictive effect on certain viruses while blocking its supporting role for others.

These approaches could lead to novel therapeutic strategies targeting a common host factor with differential effects on various viral pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.