Recombinant Pongo abelii Transmembrane protein 42 (TMEM42)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Classification

Transmembrane protein 42 (TMEM42) belongs to the broader family of transmembrane proteins, which are characterized by their structure spanning across biological membranes. These proteins function in numerous physiological processes, serving as channels, receptors, enzymes, or structural components within cellular membranes . In the case of Pongo abelii TMEM42, the protein is encoded by the TMEM42 gene and is classified as a full-length protein consisting of 159 amino acids .

Database Identifiers and Classification

The TMEM42 protein from Pongo abelii is cataloged in various biological databases, facilitating research and comparative analysis. The UniProt accession number for this protein is Q5R7Q1, which serves as a unique identifier in protein databases . While human TMEM42 is well-documented across multiple database systems including HGNC (28444), NCBI Gene (131616), Ensembl (ENSG00000169964), and UniProtKB/Swiss-Prot (Q69YG0) , the Pongo abelii ortholog information expands our understanding of evolutionary conservation of this protein across primate species.

Expression and Purification

Recombinant Pongo abelii TMEM42 is commercially available as a purified protein product for research applications. The protein is typically supplied in quantities of 50 μg, with other quantities available upon request . The expression systems for this recombinant protein are designed to maintain the structural integrity of the transmembrane domains, though specific expression methods may vary between manufacturers and production batches. The tag type used in production is determined during the production process to optimize protein folding and functionality .

Predicted Membrane Topology

As a transmembrane protein, TMEM42 is characterized by its integration into cellular membranes. Based on sequence analysis, TMEM42 is predicted to be an integral component of membranes . The protein likely contains multiple transmembrane domains that anchor it within the lipid bilayer. The hydrophobic regions in the amino acid sequence, particularly those containing alanine, leucine, and other nonpolar amino acids, likely form alpha-helical structures that span the membrane.

Experimental Applications in Protein Research

Recombinant Pongo abelii TMEM42 serves as an important tool for various research applications. It is particularly useful for:

  1. Enzyme-linked immunosorbent assays (ELISA) for detecting protein-protein interactions

  2. Structural studies of transmembrane protein organization

  3. Comparative evolutionary analysis of membrane proteins across primate species

  4. Development of antibodies against conserved transmembrane domains

The availability of purified recombinant protein enables researchers to conduct detailed biochemical and biophysical studies that would be difficult with endogenously expressed proteins due to their membrane localization and often low natural abundance.

Relevance to Transmembrane Protein Research

Transmembrane proteins like TMEM42 have gained significant attention in biomedical research due to their critical roles in cellular processes. Recent studies on other TMEM family proteins have revealed their importance in various physiological and pathological conditions, including cancer . For example, research has identified five key TMEM genes (ANO1, TMEM59, TMEM204, TMEM205, TMEM92) as having unique expression characteristics in pancreatic ductal adenocarcinoma (PDAC), offering potential targets for therapeutic approaches .

While TMEM42 was not specifically highlighted in these studies, the methodological approaches and findings from related TMEM protein research provide valuable context for understanding the potential significance of TMEM42. The characterization of recombinant Pongo abelii TMEM42 contributes to the broader field of membrane protein research by providing insights into evolutionary conservation and structural properties.

Cross-Species Conservation

The availability of TMEM42 sequence data from Pongo abelii (Sumatran orangutan) provides an opportunity for comparative analysis with human and other primate TMEM42 proteins. This comparison can reveal conserved regions that may be functionally critical, as well as species-specific variations that might reflect evolutionary adaptations. While not directly indicated in the search results, the high sequence conservation typically observed in transmembrane proteins across closely related species suggests that Pongo abelii TMEM42 likely shares significant structural and functional similarities with its human ortholog.

Evolutionary Implications

The study of TMEM42 across different primate species contributes to our understanding of membrane protein evolution. Conservation of specific domains may indicate functionally important regions that have been maintained through evolutionary pressure. Differences, on the other hand, may reflect adaptations to species-specific cellular environments or functions. The recombinant Pongo abelii TMEM42 thus serves as a valuable reference point in evolutionary studies of membrane proteins.

Current Research Limitations

Despite the availability of recombinant Pongo abelii TMEM42 for research purposes, several challenges and knowledge gaps remain:

  1. Limited functional characterization of TMEM42 compared to other transmembrane proteins

  2. Incomplete understanding of tissue-specific expression patterns in Pongo abelii

  3. Sparse information on protein-protein interactions involving TMEM42

  4. Few studies directly comparing TMEM42 function across different primate species

These limitations present opportunities for future research to expand our understanding of this transmembrane protein.

Potential Research Avenues

Future research directions for Pongo abelii TMEM42 could include:

  1. Detailed structural studies using techniques such as cryo-electron microscopy to determine precise membrane topology

  2. Functional studies to elucidate the biological roles of TMEM42 in cellular processes

  3. Comparative analyses between human and orangutan TMEM42 to identify conserved functional domains

  4. Investigation of potential associations with disease processes, similar to studies conducted with other TMEM family proteins

  5. Development of specific antibodies against Pongo abelii TMEM42 for immunohistochemical studies

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM42; Transmembrane protein 42
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM42
Target Protein Sequence
MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGSFGALAAASAKLA FGSEVSMGLCVLGIIVMASTNSLMWTFFSRGLSFSMSSAIASVTVTFSNILSSAFLGYVL YGECQEVLWWGGVFLILCGLTLIHRKLPPTWKPLPHKQQ
Uniprot No.

Target Background

Database Links

KEGG: pon:100173268

UniGene: Pab.12102

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How should recombinant TMEM42 protein be stored and handled for maximum stability?

    For optimal stability and activity of recombinant Pongo abelii TMEM42:

    • Store at -20°C for regular use

    • For extended storage, conserve at -20°C or -80°C

    • Avoid repeated freezing and thawing cycles

    • Working aliquots can be stored at 4°C for up to one week

    • The protein is typically supplied in a Tris-based buffer with 50% glycerol optimized for stability

    When planning experiments, prepare small working aliquots to minimize freeze-thaw cycles. For proteins in lyophilized form, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and consider adding glycerol (5-50% final concentration) for long-term storage .

  • What expression systems are used for producing recombinant TMEM42?

    Based on the available research data, recombinant TMEM42 from Pongo abelii has been successfully expressed using:

    • Escherichia coli (E. coli) expression systems, particularly BL21-CodonPlus(DE3)-RIPL strains, which are optimized for the expression of eukaryotic proteins with rare codons

    • For some transmembrane proteins, yeast expression systems may be utilized, as evidenced by successful expression of other Pongo abelii transmembrane proteins

    When expressing transmembrane proteins like TMEM42, the choice of expression system significantly impacts protein folding, post-translational modifications, and functional activity. E. coli systems are preferred for their high yield and simplicity, though proper folding of transmembrane domains may be challenging .

Advanced Research Questions

  • What experimental approaches are recommended for studying TMEM42 function and interactions?

    For investigating TMEM42 function and interactions, consider these methodological approaches:

    1. Protein-Protein Interaction Studies:

      • Biosensor-based binding assays using GST-tagged TMEM42 captured on biosensor chips via immobilized anti-GST antibodies

      • Pull-down assays with MBP-tagged constructs on amylose resin to identify binding partners

      • Alanine scanning mutagenesis to identify critical binding residues, as demonstrated for other transmembrane proteins

    2. Structural Analysis:

      • X-ray crystallography (though challenging for transmembrane proteins)

      • Cryo-EM approaches similar to those used for other multi-pass transmembrane proteins

      • Fusion constructs with well-behaved proteins to improve crystallization properties, as demonstrated in the ATG9A HDIR-ATG101 fusion example

    3. Functional Assays:

      • ATPase activity assays if TMEM42 has suspected enzymatic functions

      • Cell-based assays examining localization and trafficking using fluorescently tagged constructs

    These approaches should be tailored based on preliminary data about TMEM42's suspected functions and interactions.

  • How can I optimize the expression and purification of recombinant TMEM42?

    Optimizing expression and purification of TMEM42 requires addressing several technical challenges:

    Expression Optimization:

    • Use autoinduction medium (such as ZYP-5052) with temperature shift protocol: grow cells at 37°C for 5 hours, then transfer to 19°C for 16-24 hours before harvesting

    • Consider fusion tags that enhance solubility and expression, such as MBP, GST, or His tags

    • For difficult constructs, test multiple expression vectors and E. coli strains optimized for membrane proteins

    Purification Strategy:

    1. Cell lysis via sonication in buffer containing:

      • 40 mM HEPES-KOH pH 7.4

      • 500 mM KCl

      • 20% (w/v) glycerol

      • Additional stabilizing components as needed

    2. Affinity chromatography:

      • For His-tagged proteins, use immobilized metal affinity chromatography

      • For GST-tagged proteins, use glutathione sepharose

      • Include protease inhibitors to prevent degradation

    3. Size exclusion chromatography as a final polishing step

    For transmembrane proteins, consider including detergents or lipid nanodisc technology to maintain native conformation throughout purification.

  • What is known about the relationship between TMEM42 and human diseases?

    TMEM42 has been implicated in genome-wide association studies (GWAS) related to idiopathic pulmonary fibrosis (IPF):

    1. A genome-wide association study identified a signal on chromosome 3 that implicated TMEM42 along with KIF15 (a spindle-assembly related gene) in susceptibility to idiopathic pulmonary fibrosis .

    2. The study analyzed data from:

      • Chicago, Colorado, and UK studies (discovery stage)

      • UUS (USA, UK, and Spain) and Genentech studies (replication stage)

    3. Statistical analysis involved:

      • Correction for inflation due to residual fine-scale population structure

      • Conditional analyses to identify independent association signals

      • Bonferroni-corrected threshold for novel signals

    While the specific functional role of TMEM42 in IPF pathogenesis remains to be elucidated, this genetic association provides a starting point for functional studies investigating the relationship between TMEM42 and lung fibrosis mechanisms.

  • How does TMEM42 compare structurally and functionally with other TMEM family proteins?

    TMEM family proteins constitute a diverse group with varying structures and functions:

    1. Structural Comparison:

      • TMEM42 is a 159 amino acid protein with multiple transmembrane domains

      • Other TMEM proteins like TMEM43 (400 amino acids in Pongo abelii) are considerably larger and may have different membrane topology

      • While many TMEM proteins share the common feature of membrane integration, their secondary and tertiary structures can vary significantly

    2. Functional Diversity of TMEM Family:
      Research on TMEM family proteins has revealed diverse functions:

      • TMEM173 (STING) plays crucial roles in immune response pathways

      • ANO1 (TMEM16A) functions as a calcium-activated chloride channel

      • TMEM156, TMEM173, and TMEM213 have been associated with immune cell mobilization and patient survival in cancer

    3. Expression Pattern Comparison:
      A study on head and neck squamous cell carcinoma (HNSCC) identified 22 TMEM genes with varying expression profiles:

      TMEM GeneAssociated Function in HNSCC
      ANO1Linked to metastasis formation and worse survival
      TMEM156Associated with immune cell mobilization and better survival
      TMEM173Associated with immune cell mobilization and better survival
      TMEM213Correlated with clinical status and immune responses

      This diverse functionality within the TMEM family suggests that TMEM42 might have specialized roles yet to be fully characterized .

  • What methodologies are recommended for studying TMEM42 in the context of complete orangutan genome analysis?

    Recent advances in orangutan genomics provide powerful tools for studying TMEM42 in evolutionary and functional contexts:

    1. Comparative Genomic Approaches:

      • Utilize the high-quality haplotype-resolved Sumatran orangutan genome (Pongo abelii) with chromosome-level contiguity and exceptional sequence accuracy (<1 error in 500,000 base pairs)

      • Compare TMEM42 sequences between closely related species such as Bornean orangutan (Pongo pygmaeus) and Sumatran orangutan to identify evolutionary constraints and species-specific adaptations

      • The autosome sequence identity between these orangutan species is 99.5% for alignable bases

    2. Sequencing and Assembly Methodology:

      • Modern assemblies achieve telomere-to-telomere coverage with QV (quality value) scores of ~62-66

      • For analyzing TMEM42 in challenging genomic contexts, use methods that can resolve non-canonical (non-B) DNA structures including A-phased, direct, mirror, inverted, and short tandem repeats

    3. Pangenome Analysis:

      • Employ Minigraph-Cactus and Progressive Cactus approaches for interspecies comparisons

      • Reconstruct ancestral states to understand evolutionary trajectories of TMEM42

      • Compare TMEM42 across the ape phylogeny to identify conserved functional domains versus rapidly evolving regions

    These approaches enable investigation of TMEM42 in its complete genomic context rather than as an isolated gene, potentially revealing regulatory elements and evolutionary patterns.

  • What protein interaction networks might TMEM42 participate in based on studies of similar transmembrane proteins?

    While direct interaction partners of TMEM42 are not fully characterized, research on other transmembrane proteins suggests potential interaction networks:

    1. Autophagy-Related Interactions:
      Studies of transmembrane protein ATG9A reveal interactions with:

      • ATG13:ATG101 HORMA dimer through a specific HORMA dimer-interacting region (HDIR)

      • ULK1 complex components

      • These interactions are critical for processes like mitophagy mediated by the cargo receptor NDP52

    2. Potential Binding Mechanisms:

      • β-sheet complementation, as seen in the HDIR binding to the HORMA domain of ATG101

      • Backbone and side-chain interactions mediated by specific amino acid residues in binding grooves

      • The structure determined to 2.4-Å resolution for ATG9A-ATG101-ATG13 provides a model for similar transmembrane protein interactions

    3. Methodologies to Identify TMEM42 Interactions:

      • Alanine scanning mutagenesis to identify critical binding residues

      • Fusion constructs with well-behaved proteins for structural studies

      • Pull-down assays with tagged constructs

      • AlphaFold2 (AF2) prediction followed by experimental validation, as demonstrated for other protein complexes with RMSD of 0.54 Å for backbone atoms

    These approaches can help elucidate the role of TMEM42 within cellular protein networks and its potential functions in cellular processes.

  • What are the considerations for designing ELISA-based detection methods for TMEM42?

    ELISA-based detection of TMEM42 requires careful consideration of several technical aspects:

    1. Antibody Selection and Validation:

      • Develop antibodies targeting specific epitopes of TMEM42 that are accessible in the folded protein

      • For transmembrane proteins, target either extracellular domains or cytoplasmic regions

      • Validate antibody specificity against recombinant TMEM42 protein

    2. Assay Format Optimization:

      • Standard curves should be prepared using purified recombinant TMEM42 protein

      • Consider sandwich ELISA formats with capture and detection antibodies targeting different epitopes

      • For low-abundance targets, signal amplification strategies may be necessary

    3. Sample Preparation Considerations:

      • Transmembrane proteins require specialized extraction protocols using detergents

      • Membrane fractionation may improve detection sensitivity

      • Native conformation preservation is critical for antibody recognition

    4. Quantitation and Standardization:

      • Typical quantities used for recombinant protein standards: 50 μg with serial dilutions

      • Include appropriate negative and positive controls

      • Ensure linear range covers expected physiological concentrations

    These methodological considerations are essential for developing robust ELISA-based assays for TMEM42 detection in research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.