Recombinant Pongo abelii Transmembrane protein 50B (TMEM50B)

Shipped with Ice Packs
In Stock

Description

Table 1: Comparison of Recombinant TMEM50B Products

ParameterCusabio (CSB-MP023850PYX1) Creative Biomart (RFL16586HF) Wuhan Cusabio Custom
SourceMammalian cellsE. coliE. coli (in vitro)
Purity>85% (SDS-PAGE)>90% (SDS-PAGE)Not specified
FormLiquid/lyophilizedLyophilizedLyophilized
Storage-20°C/-80°C (6–12 months)-20°C/-80°C with trehalose buffer-20°C/-80°C
Reconstitution0.1–1.0 mg/mL + 50% glycerol 0.1–1.0 mg/mL + 50% glycerol Not specified

Research Findings

  • Developmental Regulation: TMEM50B is upregulated during cerebellar development and highly expressed in glial cells (e.g., Bergmann glia) .

  • Subcellular Localization: Localizes to endoplasmic reticulum (ER) and Golgi membranes, suggesting roles in vesicular transport and organelle dynamics .

  • Disease Association: Human orthologs are linked to Immunodeficiency 28 (OMIM: 617894) , though direct evidence in Pongo abelii remains unexplored.

  • Structural Predictions: Contains four transmembrane helices and a conserved C-terminal domain critical for lipid bilayer integration .

Applications

  • Biochemical Assays: SDS-PAGE validation , protein-protein interaction studies.

  • Antibody Production: Immunogen for raising species-specific antibodies .

  • Comparative Genomics: Studying transmembrane protein evolution in primates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method and location. For specific delivery timeframes, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. This can be used as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM50B; Transmembrane protein 50B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TMEM50B
Target Protein Sequence
MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA YVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0220 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TMEM50B and what cellular functions has it been associated with?

TMEM50B (transmembrane protein 50B) is a protein-coding gene also known as C21orf4 and HCVP7TP3. It is predicted to be involved in late endosome to vacuole transport via the multivesicular body sorting pathway. Recent research indicates it is primarily located in the endoplasmic reticulum . The protein is developmentally regulated and has shown significant expression patterns in neural tissues, suggesting a potential role in brain development through functions associated with precursor cells and glia .

What is the genomic context of TMEM50B in Pongo abelii compared to human TMEM50B?

In humans, TMEM50B is located on chromosome 21 at position q22.11, spanning nucleotides 33,432,486 to 33,479,974 on the complement strand and contains 11 exons . While the Pongo abelii genome has been sequenced (reference assembly NHGRI_mPonAbe1-v2.1_pri), specific comparison studies show that orangutan genetic variations exist across transmembrane proteins . Researchers studying TMEM50B across species should be aware that the Pongo abelii genome serves as the reference for the Pongo genus, which may impact comparative analyses with other orangutan species .

What are the optimal conditions for expressing recombinant Pongo abelii TMEM50B in heterologous systems?

Based on protocols for similar recombinant proteins from Pongo abelii, optimal expression can be achieved in E. coli systems with an N-terminal His tag . The recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C . For membrane proteins like TMEM50B, consider these specific recommendations:

ParameterRecommended Condition
Expression SystemE. coli
TagN-terminal His tag
FormLyophilized powder
Reconstitution BufferTris/PBS-based buffer, pH 8.0 with 6% Trehalose
Storage-20°C/-80°C, avoid repeated freeze-thaw cycles
Working AliquotsStore at 4°C for up to one week

What immunodetection methods are most effective for TMEM50B research?

Multiple validated antibodies are available for TMEM50B detection across several applications. Based on research practices, Western blot (WB) is the most commonly used technique, followed by immunohistochemistry (IHC) and immunofluorescence (IF) . The following antibodies have been validated for TMEM50B research:

CompanyApplicationsReactivityHost/IsotypeSize
Aviva Systems BiologyWBHuman, Mouse, Rat, multiple speciesRabbit IgG100 μl
Novus BiologicalsWB, ICC, IFHuman, MouseRabbit IgG20-100 μl
ProteintechWB, IHC, ELISAHuman, Mouse, RatRabbit IgG20 μl
Atlas AntibodiesICC/IFHumanRabbit IgG100 μl

For optimal results, electron microscopy has been successfully used to confirm TMEM50B localization on endoplasmic reticulum and Golgi apparatus membranes .

How can I design experiments to investigate TMEM50B involvement in neurological disorders like Down syndrome?

When investigating TMEM50B in neurological contexts, employ a multi-faceted approach similar to studies with the Ts1Cje Down syndrome mouse model :

  • Expression analysis:

    • Perform in situ hybridization at different developmental stages (e.g., embryonic day 14.5, postnatal day 7)

    • Focus on regions of interest (cerebellum, hippocampus, olfactory bulb)

    • Use quantitative PCR to measure expression across tissues (brain, heart, testis)

  • Protein localization:

    • Generate specific polyclonal antibodies against TMEM50B

    • Perform Western blot and immunohistochemistry to confirm protein expression

    • Use double immunofluorescence to co-localize with cell markers (GFAP for glia, MAP2 or β-tubulin II for neurons)

  • Subcellular distribution:

    • Confirm localization using electron microscopy

    • Investigate presence in endoplasmic reticulum and Golgi apparatus

  • Functional studies:

    • Assess expression in neural precursor cells

    • Investigate developmental regulation patterns

    • Compare expression between normal and disease models

How conserved is TMEM50B across primate species, and what might this reveal about its function?

While specific comparison data for TMEM50B across all primates is not fully detailed in the search results, the availability of genomic data for multiple orangutan species (Pongo abelii, Pongo pygmaeus, Pongo tapanuliensis) provides a foundation for comparative studies . Research on genetic variations among wild orangutans through genome-wide studies of short tandem repeats (STRs) shows that P. abelii (Sumatran orangutan) has the lowest STR dosage (3.29 ± 0.11 nucleotides added or deleted), suggesting potentially different selective pressures across species .

Researchers interested in TMEM50B conservation could:

  • Perform multiple sequence alignments across primate species

  • Calculate selective pressure using dN/dS ratios

  • Identify conserved domains that might be functionally significant

  • Compare expression patterns in homologous tissues across species

What genomic variations exist in TMEM50B between Pongo abelii and other orangutan species?

Studies comparing genomic variation between orangutan species have revealed significant differences in genetic load and heterozygosity . When analyzing TMEM50B specifically:

  • Pongo abelii (Sumatran orangutan) serves as the reference genome for the genus

  • Pongo pygmaeus (Bornean orangutan) shows greater genetic divergence with an estimated 1.094 times more indels than P. abelii

  • STR variations indicate different evolutionary trajectories, with P. abelii showing the lowest dosage (3.29 ± 0.11), followed by P. pygmaeus subspecies (3.79 ± 0.12 and 4.05 ± 0.04)

These variations might affect TMEM50B structure and function, potentially contributing to species-specific adaptations.

How do post-translational modifications of TMEM50B differ between human and Pongo abelii variants?

This area represents a knowledge gap in current research. To investigate post-translational modifications (PTMs) differences between human and Pongo abelii TMEM50B:

  • Prediction approach:

    • Use computational tools to predict potential phosphorylation, glycosylation, and other PTM sites

    • Compare predictions between human and Pongo abelii sequences

  • Experimental validation:

    • Express both variants with appropriate tags

    • Perform mass spectrometry to identify actual PTMs

    • Use specific antibodies against common PTMs

    • Compare modification patterns between species

  • Functional relevance:

    • Investigate whether differences in PTMs affect:

      • Protein localization

      • Protein-protein interactions

      • Protein stability and turnover

      • Signaling pathway involvement

How can induced pluripotent stem cell (iPSC) technology be utilized for studying TMEM50B function in Pongo abelii?

Recent advances in generating induced pluripotent stem cells from Bornean orangutans provide a valuable framework for similar applications with Pongo abelii TMEM50B research . Researchers could:

  • Generate Pongo abelii iPSCs:

    • Use Sendai virus-mediated Yamanaka factor-based reprogramming of peripheral blood mononuclear cells (PBMCs)

    • Culture cells in appropriate media (e.g., Essential 8 Flex Medium Kit and Matrigel matrix)

    • Confirm pluripotency through marker expression and differentiation capacity

  • Study TMEM50B in differentiation contexts:

    • Monitor TMEM50B expression during differentiation into neural lineages

    • Compare expression patterns to those observed in vivo

    • Investigate potential roles in cell fate determination

  • Genetic modification approaches:

    • Use CRISPR-Cas9 to modify TMEM50B in iPSCs

    • Generate knockout or reporter lines

    • Create human-orangutan chimeric proteins to study domain-specific functions

What is the potential role of TMEM50B in neurodevelopmental disorders beyond Down syndrome?

TMEM50B's expression pattern in neural tissues suggests broader implications for neurodevelopment . Recent research has identified genetic variants associated with cognitive performance that involve TMEM50B . To investigate its role in other neurodevelopmental disorders:

  • Genetic association studies:

    • Analyze TMEM50B variants in cohorts with various neurodevelopmental conditions

    • Look for SNPs or structural variants that correlate with disease phenotypes

  • Functional studies in neural models:

    • Use neural organoids to model development with modified TMEM50B expression

    • Assess impact on neural precursor proliferation, migration, and differentiation

    • Investigate glial-neuron interactions, as TMEM50B is highly expressed in glial cells

  • Protein interaction studies:

    • Identify TMEM50B binding partners in neural tissues

    • Map interaction networks to understand pathway involvement

    • Investigate whether these interactions are disrupted in disease states

How does TMEM50B interact with the host immune system in inflammatory conditions?

TMEM50B has been associated with inflammatory bowel disease (IBD) through genetic studies of host-microbe interactions . To further investigate its immunological role:

  • Expression analysis in immune tissues:

    • Profile TMEM50B expression across immune cell populations

    • Compare expression between healthy and inflammatory conditions

    • Assess regulation by inflammatory mediators (cytokines, PAMPs, etc.)

  • Functional studies:

    • Generate immune cell models with modulated TMEM50B expression

    • Assess impact on inflammatory responses (cytokine production, phagocytosis, etc.)

    • Investigate microbial interactions in relevant model systems

  • Pathway analysis:

    • Identify signaling pathways influenced by TMEM50B in immune cells

    • Determine interaction with known inflammatory mediators

    • Assess potential as a therapeutic target in inflammatory disorders

What are the main challenges in producing functional recombinant TMEM50B and how can they be overcome?

As a transmembrane protein, TMEM50B presents several challenges for recombinant production:

ChallengeSolution Strategy
Membrane protein solubilityUse specialized detergents or amphipols; consider fusion with solubility-enhancing tags
Proper foldingExpress in eukaryotic systems for complex proteins; optimize temperature and induction conditions
Post-translational modificationsConsider mammalian or insect cell expression systems when PTMs are crucial
Purification difficultiesImplement two-step purification protocols; use mild detergents during purification
Functional validationDevelop activity assays based on predicted endosome-to-vacuole transport function

For optimal results with Pongo abelii TMEM50B, researchers should:

  • Consider E. coli for initial expression trials with appropriate tags

  • Validate protein folding through circular dichroism or limited proteolysis

  • Store in optimized buffer conditions with glycerol to maintain stability

How can researchers address the challenge of studying TMEM50B function in its native membrane environment?

Studying membrane proteins in their native environment requires specialized approaches:

  • Membrane mimetics:

    • Reconstitute purified TMEM50B in liposomes or nanodiscs

    • Use detergent micelles that maintain native-like environment

    • Consider cell-free expression systems with supplied membrane components

  • Advanced imaging techniques:

    • Implement super-resolution microscopy for detailed localization

    • Use FRET-based approaches to study protein-protein interactions in membranes

    • Apply cryo-electron microscopy for structural studies

  • Functional assays:

    • Develop fluorescence-based transport assays if applicable

    • Use proteoliposomes to study transport activities

    • Implement patch-clamp techniques if channel activities are suspected

What strategies can resolve contradictory data between in vitro and in vivo studies of TMEM50B function?

When facing discrepancies between experimental systems:

  • Systematic comparison approach:

    • Document specific differences in expression, localization, or function

    • Identify variables that differ between systems (protein modifications, binding partners, membrane composition)

    • Design experiments that specifically address these variables

  • Improving model relevance:

    • Use primary cells instead of immortalized cell lines when possible

    • Implement 3D culture systems that better recapitulate tissue architecture

    • Consider ex vivo approaches with tissue explants

  • Validation across multiple systems:

    • Test hypotheses in multiple cell types and model organisms

    • Use complementary techniques to confirm observations

    • Implement tissue-specific conditional expression systems in vivo

  • Reconciliation strategies:

    • Consider context-dependent protein functions

    • Investigate regulatory mechanisms that might differ between systems

    • Develop unified models that account for observed differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.