Recombinant Pongo abelii Tumor protein p53-inducible protein 11 (TP53I11)

Shipped with Ice Packs
In Stock

Description

Functional Insights

TP53I11 is transcriptionally regulated by TP53 and modulates cellular responses to DNA damage:

  • Apoptosis Regulation: TP53I11 enhances TP53-dependent apoptosis in response to genotoxic stressors like mitomycin C and UV-C . Knockdown experiments in fibroblasts reduced TP53 signaling by 40–60% under DNA damage .

  • ER Calcium Modulation: TP53I11 influences endoplasmic reticulum Ca²⁺ levels, impacting cancer cell proliferation .

  • Cross-Species Conservation: Functional studies in mouse 3T3-L1 cells showed heterologous TP53I11 expression increased apoptosis sensitivity by 1.5–2.0-fold compared to controls .

Experimental Use Cases

  • Dual-Luciferase Reporter Assays: Used to quantify TP53 pathway activation via pGL4.38[ luc2p/p53 RE/Hygro] vectors .

  • siRNA Knockdown Studies: TP53I11-specific siRNAs (e.g., shTP53I11#1: GATCATGTGGAACGCTCTCTA) reduced TP53 signaling efficacy .

  • Protein Interaction Mapping: Direct interactions with ATXN1 suggest roles in neurodegenerative pathways .

Key Research Findings

Study FocusOutcomeSource
TP53 Pathway AmplificationTP53I11 knockdown reduced DNA damage response efficacy by 50%
Evolutionary ContextTP53 paralogs (TP53RTG) in elephants show conserved apoptotic roles
Calcium SignalingTP53I11 modulates ER Ca²⁺ to inhibit cancer cell growth

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TP53I11; PIG11; Tumor protein p53-inducible protein 11; p53-induced gene 11 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TP53I11
Target Protein Sequence
MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPL GLRVWQFLSAVLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFGVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYY QVGRRPKKA
Uniprot No.

Target Background

Database Links

KEGG: pon:100171701

UniGene: Pab.14094

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TP53I11 and what are its alternative names in scientific literature?

TP53I11 (Tumor protein p53-inducible protein 11) is a p53-induced gene product also known as p53-induced gene 11 protein (PIG11). The protein is encoded by the TP53I11 gene, which is an early transcription-related target of p53 involved in cell apoptosis and tumor development . The gene has been identified in various species, including humans and non-human primates like Pongo abelii (Sumatran orangutan). In scientific literature, you may encounter this protein referred to by either its full name, the abbreviation TP53I11, or its synonym PIG11, depending on the research context and publication date .

What is the biological role of TP53I11 in normal cellular function?

TP53I11 plays critical roles in several cellular processes:

  • Calcium homeostasis regulation: TP53I11 is a key regulator of endoplasmic reticulum (ER) Ca²⁺ levels. Overexpression of TP53I11 leads to elevated ER Ca²⁺ levels, while knockdown results in decreased ER Ca²⁺ levels .

  • Cell proliferation control: As a p53 target gene, TP53I11 is involved in the regulation of cell proliferation, with evidence suggesting tumor suppressor properties in some cancer contexts .

  • Angiogenesis regulation: Recent research has revealed that TP53I11 is associated with endothelial cells and plays a significant role in tumor angiogenesis. It can promote angiogenic functions of human umbilical vein endothelial cells (HUVECs) in vitro .

  • Response to cellular stress: TP53I11 expression is upregulated in response to chemotherapeutic agents like doxorubicin (DOX), suggesting its involvement in stress-response pathways .

How does TP53I11 influence endoplasmic reticulum calcium homeostasis and what are the downstream consequences?

TP53I11 serves as a critical regulator of endoplasmic reticulum (ER) Ca²⁺ homeostasis. Research has demonstrated that:

  • Mechanistic action: TP53I11 functions downstream of multiple microRNAs in the regulation of ER Ca²⁺ levels. When TP53I11 is downregulated by these miRNAs, basal ER Ca²⁺ levels decrease significantly .

  • Experimental evidence: Ca²⁺ imaging studies in both HEK293 and HeLa cell lines have shown that knockdown of TP53I11 using shRNA constructs (particularly shTP53I11#1) results in a significant reduction in the TuNer-s ratio, indicating decreased ER Ca²⁺ levels. Conversely, overexpression of TP53I11 leads to a notable increase in basal ER Ca²⁺ levels .

  • Downstream effects: The alteration of ER Ca²⁺ levels by TP53I11 has profound effects on cellular processes, including:

    • Cell proliferation rates, particularly in cancer cells

    • Potential influence on ER stress responses

    • Modulation of Ca²⁺-dependent signaling pathways

  • Therapeutic implications: The ability of TP53I11 to elevate ER Ca²⁺ levels, particularly when upregulated by chemotherapeutic agents like doxorubicin, suggests a novel therapeutic mechanism whereby increasing ER Ca²⁺ accumulation could enhance anticancer efficacy .

What is the relationship between TP53I11 expression and cancer prognosis across different tumor types?

TP53I11 exhibits complex and tissue-specific relationships with cancer prognosis:

Cancer TypeTP53I11 ExpressionPrognostic ImpactReference
BRCA (Breast cancer)HighDetrimental to survival
KIRP (Kidney renal papillary cell carcinoma)HighDetrimental to survival
MESO (Mesothelioma)HighDetrimental to survival
UVM (Uveal melanoma)HighDetrimental to survival
KIRC (Kidney renal clear cell carcinoma)HighBeneficial to survival
Gastric cancerHighPoor prognosis

This pan-cancer analysis reveals the context-dependent nature of TP53I11's impact on cancer outcomes. The variation in prognostic significance may be related to tissue-specific functions of TP53I11, differences in regulatory networks, or the tumor microenvironment in different cancer types .

How is TP53I11 regulated at the epigenetic and post-translational levels in cancer?

TP53I11 undergoes multiple levels of regulation in cancer:

  • DNA methylation: There is a negative correlation between TP53I11 expression and DNA methylation in most cancer types, suggesting epigenetic regulation as a key mechanism controlling TP53I11 levels .

  • Post-translational modifications: The S14 residue of TP53I11 is phosphorylated in several cancer types, indicating potential regulation through phosphorylation that may affect protein function, stability, or interactions .

  • microRNA regulation: Multiple microRNAs target TP53I11 mRNA for degradation or translational repression. Research has identified at least 10 miRNAs that significantly lower TP53I11 expression, including hsa-miR-210-3p, hsa-miR-210-5p, and hsa-miR-645. This represents an important post-transcriptional regulatory mechanism .

  • Hypoxia-induced regulation: TP53I11 is transcriptionally upregulated by HIF2A under hypoxic conditions, which connects its expression to the tumor microenvironment and oxygen availability .

  • p53-dependent regulation: As its name suggests, TP53I11 is a p53-inducible gene. The functional status of p53 in cancer cells therefore directly impacts TP53I11 expression levels .

What are the optimal storage and handling conditions for recombinant Pongo abelii TP53I11 protein?

For optimal storage and handling of recombinant Pongo abelii TP53I11:

  • Storage temperature:

    • For regular use: Store at -20°C

    • For extended storage: Conserve at -20°C or -80°C

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer composition:

    • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for this specific protein

  • Avoiding degradation:

    • Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity

    • Prepare small working aliquots upon first thaw to minimize freeze-thaw cycles

  • Handling precautions:

    • Maintain sterile conditions when handling the protein

    • Follow standard protein handling protocols to prevent contamination and degradation

    • Consider the addition of protease inhibitors if working with cell lysates or during extended experimental procedures

What assays can be used to study TP53I11's role in regulating endoplasmic reticulum calcium levels?

Several experimental approaches have been validated for studying TP53I11's role in ER Ca²⁺ regulation:

  • Ca²⁺ imaging using TuNer-s system:

    • The TuNer-s (Tune Endoplasmic Reticulum sensors) ratio provides a quantitative measure of ER Ca²⁺ levels

    • This fluorescent protein-based approach allows real-time monitoring of ER Ca²⁺ in living cells

    • Both basal levels and dynamic changes in ER Ca²⁺ can be measured in response to TP53I11 manipulation

  • Genetic manipulation approaches:

    • shRNA knockdown: Design specific shRNAs targeting TP53I11 (e.g., shTP53I11#1) and confirm knockdown efficiency through RT-qPCR

    • Overexpression: Transfect cells with TP53I11 expression vectors and confirm through Western blot

    • CRISPR/Cas9 knockout: Generate complete knockout cell lines for more definitive functional studies

  • Pharmacological interventions:

    • Doxorubicin (DOX) treatment (25 nM for 48h) can be used to upregulate TP53I11 expression

    • Combined with Ca²⁺ imaging, this approach can reveal how drug-induced TP53I11 expression affects ER Ca²⁺ homeostasis

  • RT-qPCR and Western blot analysis:

    • These standard techniques are essential for confirming changes in TP53I11 expression at mRNA and protein levels, respectively

    • They should be used to validate the effectiveness of genetic manipulations before proceeding to functional assays

How can researchers effectively study the angiogenic function of TP53I11 in vitro?

To investigate TP53I11's role in angiogenesis, researchers can employ the following validated in vitro approaches:

  • Microvessel sprouting assay:

    • This assay measures the formation of sprouts from endothelial cell spheroids

    • Manipulate TP53I11 expression through overexpression or knockout in HUVECs

    • Compare sprouting capacity under normoxic and hypoxic conditions

  • Tube formation assay:

    • Plate HUVECs on Matrigel and quantify the formation of capillary-like structures

    • Parameters to measure include tube length, number of branch points, and network complexity

    • TP53I11 overexpression enhances tube formation while knockout attenuates it

  • Endothelial cell proliferation assay:

    • Use standard proliferation assays (MTT, BrdU incorporation, or real-time cell analysis) to assess how TP53I11 affects endothelial cell growth rates

    • Transfection efficiency should be monitored (e.g., using eGFP reporter, ~75% efficiency achievable)

  • Migration assay:

    • Employ scratch wound healing or transwell migration assays to evaluate endothelial cell motility

    • TP53I11 overexpression enhances migration while knockout reduces it

  • Hypoxia experiments:

    • Compare angiogenic functions under normoxic versus hypoxic conditions

    • Investigate the HIF2A-mediated upregulation of TP53I11 under hypoxia

    • Standard hypoxia chambers or chemical mimetics (e.g., CoCl₂) can be used

How should researchers approach pan-cancer analysis of TP53I11 expression and its correlation with patient outcomes?

When conducting pan-cancer analysis of TP53I11 expression and its clinical correlations, consider the following methodological approaches:

  • Expression analysis across cancer types:

    • Compare TP53I11 expression between tumor and normal tissues across multiple cancer types

    • Use standardized datasets like TCGA for consistency

    • Apply appropriate normalization methods to account for batch effects

    • Present results in a comparative visualization showing expression patterns across cancer types

  • Survival analysis methodology:

    • Stratify patients into high and low TP53I11 expression groups (median split or optimal cutpoint)

    • Generate Kaplan-Meier survival curves for each cancer type

    • Calculate hazard ratios with 95% confidence intervals

    • Perform multivariate analysis to control for confounding factors (age, stage, grade)

    • Be aware that TP53I11's impact varies by cancer type - beneficial in some (KIRC) but detrimental in others (BRCA, KIRP, MESO, UVM)

  • Correlation with molecular features:

    • Analyze the relationship between TP53I11 expression and:

      • DNA methylation status

      • Mutation burden

      • p53 mutation status

      • Specific molecular subtypes of each cancer

  • Interpretation frameworks:

    • Consider tissue-specific contexts when interpreting results

    • Integrate findings with known biological functions (ER Ca²⁺ regulation, angiogenesis)

    • Acknowledge limitations in correlative studies vs. causal relationships

What are the common pitfalls in analyzing TP53I11's role in calcium homeostasis and how can they be avoided?

When investigating TP53I11's role in calcium homeostasis, researchers should be aware of these potential pitfalls and their solutions:

How might TP53I11-targeted therapies be developed for cancer treatment?

The development of TP53I11-targeted therapies for cancer represents a promising research direction, with several potential approaches:

  • Direct TP53I11 modulation strategies:

    • For cancers where high TP53I11 is detrimental (BRCA, KIRP, MESO, UVM): Develop small molecule inhibitors or targeted antibodies against TP53I11

    • For cancers where TP53I11 acts as a tumor suppressor: Design approaches to upregulate or stabilize TP53I11 expression, potentially through epigenetic modulators targeting its promoter methylation

  • ER Ca²⁺ homeostasis as a therapeutic target:

    • Develop compounds that mimic TP53I11's effect on ER Ca²⁺ levels

    • Combination therapies with doxorubicin, which has been shown to upregulate TP53I11 and enhance ER Ca²⁺ accumulation

    • Design strategies to specifically disrupt cancer cell Ca²⁺ homeostasis while sparing normal cells

  • Anti-angiogenic approach:

    • For tumors where TP53I11 promotes angiogenesis: Develop inhibitors targeting the TP53I11-mediated angiogenic pathway

    • Consider combination with existing anti-angiogenic therapies

    • Explore HIF2A inhibitors to reduce hypoxia-induced TP53I11 expression in the tumor microenvironment

  • microRNA-based therapeutics:

    • Design miRNA mimics based on the identified 10 miRNAs that downregulate TP53I11

    • Develop anti-miRNA approaches for contexts where TP53I11 upregulation is beneficial

    • Consider tissue-specific delivery systems to target specific tumor types

What are the unresolved questions regarding the mechanism of TP53I11 in regulating angiogenesis?

Despite recent advances, several key questions about TP53I11's role in angiogenesis remain unresolved:

  • Molecular mechanism of action:

    • How does TP53I11 directly influence endothelial cell function at the molecular level?

    • What are the immediate downstream effectors of TP53I11 in endothelial cells?

    • Does TP53I11's regulation of ER Ca²⁺ levels directly connect to its angiogenic function?

  • Context-dependent effects:

    • Why does TP53I11 show different prognostic implications across cancer types?

    • How do tissue-specific factors influence TP53I11's angiogenic function?

    • What determines whether TP53I11 will promote or inhibit tumor progression in different contexts?

  • Interaction with established angiogenic pathways:

    • How does TP53I11 interact with VEGF signaling, the primary angiogenic pathway?

    • Does TP53I11 affect pericyte recruitment and vessel maturation, or primarily endothelial sprouting?

    • Are there synergistic effects between TP53I11 and other hypoxia-responsive angiogenic factors?

  • In vivo validation:

    • Do the in vitro findings about TP53I11's angiogenic function translate to in vivo tumor models?

    • Would TP53I11 inhibition result in reduced tumor vascularity and growth?

    • How does the tumor microenvironment modify TP53I11's angiogenic effects?

  • Translational potential:

    • Can TP53I11 serve as a biomarker for response to anti-angiogenic therapies?

    • Would tumors with high TP53I11 expression show greater sensitivity to drugs targeting HIF2A or calcium homeostasis?

    • Could circulating levels of TP53I11 correlate with tumor angiogenic activity?

How can multi-omics approaches advance our understanding of TP53I11 biology?

Integration of multi-omics approaches offers powerful opportunities to advance TP53I11 research:

  • Genomics and epigenomics integration:

    • Comprehensive analysis of TP53I11 promoter regulation across tissues

    • Identification of enhancer elements and transcription factor binding sites

    • Examination of the relationship between DNA methylation patterns and TP53I11 expression in different cellular contexts

  • Transcriptomics applications:

    • RNA-seq analysis to identify genes co-regulated with TP53I11

    • Alternative splicing analysis to detect potential isoforms with distinct functions

    • Single-cell transcriptomics to map TP53I11 expression in heterogeneous tumor microenvironments

  • Proteomics and interactomics:

    • Identification of TP53I11 binding partners through immunoprecipitation-mass spectrometry

    • Phosphoproteomic analysis to characterize the significance of S14 phosphorylation and identify other post-translational modifications

    • Protein-protein interaction networks to place TP53I11 in broader cellular signaling pathways

  • Metabolomics considerations:

    • Analysis of metabolic changes associated with TP53I11 manipulation

    • Focus on calcium-dependent metabolic pathways

    • Investigation of potential links between TP53I11, calcium homeostasis, and cellular metabolism

  • Integrative analysis frameworks:

    • Machine learning approaches to integrate multi-omics data and predict TP53I11 function in different contexts

    • Network analysis to position TP53I11 within cellular signaling networks

    • Systems biology modeling of TP53I11's role in calcium homeostasis and angiogenesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.