Recombinant Pongo abelii Uncharacterized protein C1orf43 homolog

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pongo abelii Uncharacterized Protein C1orf43 Homolog

The Recombinant Pongo abelii Uncharacterized Protein C1orf43 Homolog is a protein expressed in E. coli and tagged with N-terminal His . The protein is a full-length form consisting of 189 amino acids . Pongo abelii is the scientific name for the Sumatran orangutan . The term "uncharacterized protein" suggests that the function and specific role of this protein are not yet fully understood or defined through experimental studies . Proteins of this nature are identified through genomic and proteomic analyses, but their precise biological activities require further investigation .

Protein Information

CategoryDescription
SpeciesPongo abelii (Sumatran orangutan)
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-189 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
UniProt IDQ5RF08
SynonymsProtein C1orf43 homolog
AA SequenceMASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATA
Expression Region1-189

Biochemical Functions and Pathways

The Pongo abelii Uncharacterized Protein C1orf43 homolog is involved in various biochemical functions and pathways . Further studies are needed to elucidate the specific roles and interactions of this protein in cellular processes . This protein may participate in multiple pathways and interact with other proteins . Further research may reveal its involvement in specific biological processes .

Applications in Research

Recombinant proteins are essential tools in biological research, utilized in a variety of applications .

  • ELISA assays Recombinant Pongo abelii Uncharacterized Protein C1orf43 homolog can be employed in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying the protein in biological samples .

  • Case studies Recombinant proteins are useful in case studies to understand the effects of certain protein interactions in tumor microenvironments .

  • Interaction studies Recombinant proteins facilitate the study of protein-protein interactions, helping to identify binding partners and understand functional relationships .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to your requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Protein C1orf43 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Protein Sequence
MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSE GRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQ EALSELATA
Uniprot No.

Target Background

Function
A general regulator of phagocytosis, essential for the uptake of Gram-negative bacteria by macrophages.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein. Golgi apparatus. Mitochondrion.

Q&A

What are the known or predicted functions of C1orf43 homologs based on current research?

Recent research has characterized C1orf43 as a regulator of phagocytosis. Studies using knockout cell lines have demonstrated that C1orf43 plays a critical role in cellular uptake mechanisms. C1orf43 knockout cells exhibit significant defects in the phagocytosis of various substrates including gram-negative bacteria (Legionella pneumophila, Escherichia coli), gram-positive bacteria (Staphylococcus aureus), fungal components (zymosan from yeast cell wall), and synthetic particles (polystyrene beads) .

This functional characterization suggests that C1orf43 homologs, including the Pongo abelii variant, likely participate in fundamental cellular processes related to membrane trafficking and endocytosis. The protein appears to be evolutionarily conserved from Drosophila to humans, indicating its biological importance .

How should researchers properly store and reconstitute the recombinant protein?

For optimal stability and activity, follow these methodological guidelines:

Storage ConditionRecommendation
Long-term storageStore at -20°C/-80°C upon receipt
Working aliquotsStore at 4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
AliquotingNecessary for multiple use to avoid repeated freeze-thaw cycles

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

Note that repeated freezing and thawing is not recommended as it may affect protein stability and activity.

What expression systems are optimal for producing recombinant Pongo abelii C1orf43 homolog?

The commercially available Recombinant Pongo abelii C1orf43 homolog is typically expressed in E. coli expression systems with an N-terminal His tag . This prokaryotic expression system is advantageous for:

  • High yield of recombinant protein

  • Cost-effectiveness and scalability

  • Simplified purification via affinity chromatography using the His tag

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications
Mammalian cellsNative-like post-translational modificationsLower yield, higher cost, longer production time
Insect cellsIntermediate between E. coli and mammalian systemsModerate cost, good for eukaryotic proteins
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, potentially lower yield

When selecting an expression system, consider whether post-translational modifications are critical for your research application, as these may affect protein folding, function, and interaction studies.

What methodological approaches can be used to investigate the role of C1orf43 in phagocytosis?

Based on current research findings, several experimental approaches can be employed to investigate C1orf43's role in phagocytosis:

  • Knockout/Knockdown Studies:

    • Generate C1orf43 knockout cell lines using CRISPR-Cas9 technology

    • Create knockdown models using siRNA or shRNA

    • Compare phagocytic ability with wild-type cells using various substrates

  • Fluorescence-Based Phagocytosis Assays:

    • Use pHrodo dye-conjugated particles (bacteria, zymosan, beads)

    • Measure uptake using automated fluorescence microscopy or flow cytometry

    • Quantify changes in phagocytic capacity between wild-type and C1orf43-deficient cells

  • Protein Localization Studies:

    • Use immunofluorescence to track C1orf43 localization during phagocytosis

    • Perform live-cell imaging with tagged C1orf43 to observe dynamics during uptake

    • Co-localization studies with known phagocytic pathway markers

  • Interaction Partner Identification:

    • Perform immunoprecipitation followed by mass spectrometry

    • Use yeast two-hybrid screening

    • Conduct proximity labeling (BioID, APEX) to identify proximal proteins

  • Complementation Assays:

    • Rescue phagocytic defects by reintroducing wild-type C1orf43

    • Test mutant variants to identify functional domains

These methodological approaches provide comprehensive strategies to elucidate the specific mechanisms by which C1orf43 regulates phagocytosis .

How can researchers perform homology analysis of Pongo abelii C1orf43 homolog against human proteome?

  • BLAST Analysis Protocol:

    • Use BLASTp tool with the Pongo abelii C1orf43 sequence as query

    • Search against the human proteome database

    • Apply thresholds: ≥35% identity, ≥35% query coverage, and <10e-5 E-value to identify homologous proteins

  • Multiple Sequence Alignment:

    • Align the Pongo abelii C1orf43 sequence with human homologs using tools like Clustal Omega, MUSCLE, or T-Coffee

    • Identify conserved residues and domains

    • Generate phylogenetic trees to visualize evolutionary relationships

  • Domain Architecture Analysis:

    • Compare the domain organization between Pongo abelii and human proteins

    • Identify conserved functional motifs

    • Predict structure-function relationships based on domain conservation

  • Structural Homology Modeling:

    • Generate 3D structural models using homology modeling tools

    • Compare predicted structures to identify conservation of binding sites and active centers

    • Analyze structural features that may impact protein function

This systematic approach allows researchers to identify human orthologs of the Pongo abelii C1orf43 homolog and make predictions about functional conservation across species.

What is the evolutionary significance of C1orf43 conservation across species?

The C1orf43 protein appears to be highly conserved from Drosophila to humans, suggesting fundamental biological importance . To investigate the evolutionary significance:

  • Phylogenetic Analysis Methodology:

    • Collect C1orf43 homolog sequences from diverse species

    • Perform multiple sequence alignments

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Calculate evolutionary rates to identify regions under selective pressure

  • Functional Domain Conservation:

    • Map conserved regions to functional domains

    • Identify invariant residues that may be critical for function

    • Compare conservation patterns with known functional data

  • Synteny Analysis:

    • Examine genomic context of C1orf43 homologs across species

    • Identify conservation of gene neighborhoods

    • Analyze potential co-evolution with interacting partners

The high conservation of C1orf43 across diverse species, combined with its role in fundamental cellular processes like phagocytosis, suggests it may be part of the core cellular machinery that evolved early in eukaryotic evolution. Understanding this evolutionary context can provide insights into the protein's essential functions and help predict critical functional domains .

How can researchers determine if Pongo abelii C1orf43 homolog is involved in bacterial pathogenesis?

To determine potential roles in bacterial pathogenesis, researchers can employ these methodological approaches:

  • Virulence Factor Database Analysis:

    • Query the Virulence Factor Database (VFDB) to check if C1orf43 homologs are known virulence factors

    • Compare sequence similarities with established virulence-associated proteins

  • Infection Models:

    • Develop cell culture infection models using wild-type and C1orf43-deficient cells

    • Challenge with pathogenic bacteria (e.g., Legionella pneumophila)

    • Assess differences in bacterial uptake, survival, and replication

    • Measure host cell responses including cytokine production and cell death

  • Bacterial Pathogen Interaction Studies:

    • Identify whether pathogenic bacteria target C1orf43 during infection

    • Screen for bacterial effector proteins that interact with C1orf43

    • Investigate if C1orf43 is modified or degraded during infection

  • Transcriptomic Analysis:

    • Compare gene expression profiles between infected and uninfected cells

    • Focus on C1orf43 expression changes during infection

    • Identify co-regulated genes that may function in the same pathway

The known role of C1orf43 in phagocytosis suggests it may influence bacterial uptake and potentially impact host-pathogen interactions, particularly with intracellular pathogens like Legionella pneumophila that manipulate host cell processes .

What approaches can be used to identify potential binding partners and interaction networks of C1orf43 homologs?

Understanding the protein interaction network is crucial for elucidating C1orf43's function. Consider these methodological approaches:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged C1orf43 in relevant cell lines

    • Perform pulldown experiments to isolate protein complexes

    • Identify interacting partners using mass spectrometry

    • Validate interactions using reciprocal pulldowns

  • Proximity-Dependent Biotinylation (BioID/TurboID):

    • Fuse C1orf43 to a biotin ligase (BirA* or TurboID)

    • Express the fusion protein in cells and allow proximity labeling

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach captures both stable and transient interactions

  • Yeast Two-Hybrid Screening:

    • Use C1orf43 as bait to screen against cDNA libraries

    • Identify positive interactions through reporter gene activation

    • Confirm interactions using alternative methods

  • Co-immunoprecipitation and Western Blotting:

    • Use specific antibodies against C1orf43 to pull down protein complexes

    • Identify known interactors using targeted western blotting

    • This approach works well for confirming predicted interactions

  • Protein Correlation Profiling:

    • Fractionate cellular components using density gradients or chromatography

    • Track co-elution patterns of C1orf43 with other proteins

    • Identify proteins with similar profiles as potential interactors

These complementary approaches can help construct a comprehensive interaction network, providing insights into the functional context of C1orf43 homologs.

What are the common challenges in working with uncharacterized proteins like C1orf43 homolog, and how can researchers overcome them?

Working with uncharacterized proteins presents several technical challenges. Here are methodological solutions to address them:

ChallengeSolutionMethodological Approach
Limited functional informationSystematic characterizationUse computational prediction tools, perform domain analysis, test for common enzymatic activities
Lack of validated antibodiesCustom antibody developmentGenerate and validate antibodies against specific epitopes or use epitope tagging approaches
Unknown subcellular localizationLocalization studiesUse fluorescent protein fusions, immunofluorescence with custom antibodies, or subcellular fractionation
Unpredictable solubilityOptimization of expression conditionsTest multiple expression systems, solubility tags, buffer conditions, and purification methods
Unknown stabilityStability screeningPerform thermal shift assays, optimize buffer conditions, test stabilizing additives
Difficulty in functional assaysPhenotypic screeningUse gene knockout/knockdown approaches followed by broad phenotypic assays to identify affected pathways

For C1orf43 specifically, researchers should leverage its known association with phagocytosis to design targeted functional assays . This provides a starting point for deeper characterization of its biochemical and cellular functions.

How can researchers identify and characterize conserved domains in the Pongo abelii C1orf43 homolog?

To identify and characterize conserved domains, follow this methodological workflow:

  • Computational Domain Prediction:

    • Use NCBI Conserved Domain Search Service (CDD) to identify known domains

    • Implement Reverse Position Specific (RPS)-BLAST against position specific scoring matrices (PSSMs)

    • Apply InterProScan to integrate results from multiple domain databases

    • Use SMART, Pfam, and ProSite for specialized domain searches

  • Structural Analysis:

    • Generate structural predictions using AlphaFold2 or RoseTTAFold

    • Compare predicted structures with known domain structures

    • Identify structural motifs that may indicate function

  • Experimental Domain Mapping:

    • Create truncation mutants to isolate functional domains

    • Test each construct for specific activities or interactions

    • Use limited proteolysis to identify structured domains resistant to digestion

  • Functional Annotation:

    • Based on identified domains, predict potential functions

    • Design targeted assays to test functional predictions

    • Validate through mutation of key residues within predicted domains

This systematic approach combines computational predictions with experimental validation to characterize domains in previously uncharacterized proteins like C1orf43.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.