Recombinant Pongo abelii Uncharacterized protein C4orf34 homolog

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pongo abelii Uncharacterized protein C4orf34 homolog is a synthetic version of the C4orf34 protein (also known as SMIM14) produced in laboratory systems for research purposes. This protein belongs to a conserved family of small integral membrane proteins and is homologous to human C4orf34, which is localized to the endoplasmic reticulum (ER) and implicated in ER functions . The recombinant variant from Pongo abelii (Sumatran orangutan) is used to study evolutionary conservation, structural properties, and functional roles of C4orf34 in cellular processes.

Expression and Localization

  • Species Origin: Pongo abelii (Sumatran orangutan) .

  • Homolog Conservation: High sequence similarity (e.g., 89.7% with mouse C4orf34) .

  • Subcellular Localization: Endoplasmic reticulum (ER) membrane, confirmed via co-localization with ER markers (e.g., calnexin, Sec61β) .

ER Retention Mechanism

Human C4orf34’s TMD is critical for ER retention:

  • Transmembrane Domain Role: Length and hydrophobic composition of the TMD prevent forward transport to the Golgi .

  • Topology: N-terminus faces the ER lumen, C-terminus faces the cytoplasm (confirmed via N-glycosylation and FRB-rapamycin assays) .

Functional Insights

PropertyDetailSource
ER Stress ResponseNo significant upregulation during ER stress (e.g., BiP/GRP78 induction)
Protein InteractionsProline-rich C-terminus may recruit SH3-domain proteins for signaling
Disease AssociationPotential link to mitochondrial complex III deficiency (indirect evidence)

Comparative Analysis with Human SMIM14

FeaturePongo abelii C4orf34Human SMIM14 (C4orf34)
Uniprot IDQ5RF07Q96QK8
Tissue ExpressionUbiquitous (inferred)Ubiquitous
ER LocalizationConfirmedConfirmed
Disease RelevanceLimited dataMitochondrial disorders

Uses in Research

  • ELISA and Immunological Studies: Detects C4orf34-specific antibodies .

  • Structural Biology: Facilitates studies of TMD-mediated ER retention .

  • Functional Assays: Investigates ER stress responses and calcium homeostasis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SMIM14; Small integral membrane protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SMIM14
Target Protein Sequence
MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAW MVIALILFLLRPPNLRGSNLPGKPTSPHNGQDPPAPPVD
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is C4orf34 and how conserved is it across species?

C4orf34 is a protein encoded by the chromosome 4 open reading frame 34 gene. Research has demonstrated that human C4orf34 (hC4orf34) is highly conserved from invertebrates to mammals, with remarkable sequence homology across species. The amino acid sequence similarity between human C4orf34 and its homologs is approximately 89.7% for mouse, 69.7% for zebrafish (Danio), and 70.7% for Xenopus, indicating substantial evolutionary conservation . This high degree of conservation suggests functional importance in cellular processes that have been maintained through evolutionary history.

What is the cellular localization and topology of C4orf34?

C4orf34 is a novel endoplasmic reticulum (ER)-resident, type I transmembrane protein. Research utilizing asparagine-linked glycosylation modifications has determined its specific topology: the N-terminus is located within the luminal side of the ER, while the C-terminus is positioned on the cytoplasmic side . This topology was confirmed through multiple experimental approaches, including the use of an inducible system involving the ternary complex between FKBP, rapamycin, and the rapamycin-binding domain of mTOR (FRB) . The transmembrane domain (TMD) of C4orf34 has been shown to be critically involved in its retention in the ER membrane.

What is the expression pattern of C4orf34 in mammalian tissues?

RT-PCR analysis using specific primer sets from different exons has demonstrated that mouse C4orf34 (mC4orf34) is ubiquitously expressed across various tissues. High expression levels have been documented in the heart, thymus, and hippocampus, indicating a potentially important role in these organs . This widespread expression pattern suggests that C4orf34 may be involved in fundamental cellular processes common to multiple tissue types rather than having a tissue-specific function.

What potential functional roles does C4orf34 play in cellular processes?

Based on its localization and structural features, C4orf34 is hypothesized to play roles in ER functions, including calcium homeostasis and ER stress responses. The C-terminal region of C4orf34 contains proline-rich sequences (PXXP motifs), which are typically important for protein-protein interactions, particularly with SH3 domain-containing proteins . This suggests that C4orf34 might function as a transmembrane adaptor protein (TRAP), potentially recruiting cytoplasmic proteins to the ER membrane. While the exact function remains to be fully elucidated, its evolutionary conservation and specific localization point to potentially crucial roles in cellular processes.

How can researchers experimentally determine the binding partners of C4orf34?

To identify binding partners of C4orf34, researchers can employ several complementary approaches:

  • Co-immunoprecipitation (Co-IP): Express tagged versions of C4orf34 (such as FLAG-tagged or GFP-tagged constructs) in cellular systems, immunoprecipitate the protein complex, and identify associated proteins through mass spectrometry .

  • Yeast two-hybrid screening: Use the cytoplasmic domain (particularly the proline-rich C-terminal region) as bait to screen for interacting proteins, especially those containing SH3 domains known to bind proline-rich motifs.

  • Proximity labeling techniques: Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to C4orf34 in living cells, providing insights into its protein interaction network within the native cellular environment.

  • Pull-down assays: Utilize recombinant C4orf34 protein immobilized on a solid support to capture binding partners from cell lysates, followed by identification through western blotting or mass spectrometry.

What are the optimal storage and handling conditions for recombinant C4orf34 protein?

Recombinant C4orf34 protein should be stored in Tris-based buffer containing 50% glycerol at -20°C for regular use or at -80°C for extended storage . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity. For ongoing experiments, working aliquots may be stored at 4°C for up to one week . The high glycerol content in the storage buffer helps maintain protein stability by preventing ice crystal formation and protein denaturation during freezing.

How can researchers validate the expression of C4orf34 in their experimental systems?

Researchers can validate C4orf34 expression through multiple approaches:

  • RT-PCR: Design primers spanning different exons to detect C4orf34 mRNA while avoiding genomic DNA contamination. This approach has been successfully used to detect expression across various mouse tissues .

  • Western blotting: Use specific antibodies against C4orf34 or against tags (such as FLAG or GFP) if using tagged constructs. The expected molecular weight of full-length C4orf34 is approximately 11 kDa, though this may vary with post-translational modifications or tags.

  • Immunofluorescence microscopy: Visualize cellular localization using fluorescently tagged C4orf34 constructs or antibodies against the native protein. Proper localization to the ER can be confirmed by co-localization with established ER markers .

  • N-glycosylation analysis: For constructs with engineered N-glycosylation sites, treatment with tunicamycin (an N-glycosylation inhibitor) can confirm proper protein topology and ER targeting .

How might C4orf34 be involved in calcium homeostasis in the ER?

While direct evidence linking C4orf34 to calcium homeostasis is still emerging, its ER localization positions it to potentially interact with calcium regulatory machinery. Researchers could investigate this by:

  • Measuring intracellular and ER calcium levels in cells overexpressing or depleted of C4orf34 using fluorescent calcium indicators.

  • Examining potential interactions between C4orf34 and known calcium channels, pumps, or calcium-binding proteins in the ER through co-immunoprecipitation or proximity labeling.

  • Assessing calcium flux in response to ER stressors in control versus C4orf34-manipulated cells.

  • Evaluating whether the cytoplasmic domain of C4orf34 shows calcium-dependent conformational changes or binding patterns, given its proline-rich regions that might function in signaling.

What are the approaches to determine the functional significance of C4orf34 conservation across species?

The high evolutionary conservation of C4orf34 suggests important biological functions. To investigate this significance, researchers could:

  • Perform cross-species complementation experiments to determine if C4orf34 homologs from different species can functionally substitute for each other.

  • Create domain swaps between homologs to identify functionally critical regions conserved across evolution.

  • Utilize comparative genomics to correlate the presence/absence or structural variations of C4orf34 with specific physiological or developmental traits across species.

  • Implement knockout/knockdown studies across multiple model organisms to identify conserved phenotypes that might reveal fundamental functions.

  • Conduct detailed structural analysis of C4orf34 homologs to identify conserved structural motifs that might provide insights into function.

What methods can be used to study C4orf34's role in the ER stress response?

To investigate C4orf34's potential involvement in ER stress responses, researchers can employ several analytical approaches:

  • Gene expression analysis during ER stress: Monitor C4orf34 protein levels (as opposed to just mRNA) during ER stress using western blotting, as post-transcriptional regulation might occur despite unchanged mRNA levels .

  • Interaction studies with UPR components: Examine potential interactions between C4orf34 and key unfolded protein response (UPR) proteins such as IRE1, PERK, or ATF6 through co-immunoprecipitation or proximity labeling.

  • ER stress phenotypes in C4orf34-modified cells: Compare ER stress sensitivity in wild-type cells versus those overexpressing or depleted of C4orf34, measuring cellular outcomes such as apoptosis rates, UPR activation kinetics, or protein folding capacity.

  • Structural studies of the ER lumen under stress: Employ electron microscopy to visualize ER morphology changes during stress in relation to C4orf34 expression or localization.

How can researchers generate mutant C4orf34 constructs for functional studies?

Based on published methodologies, researchers can generate various C4orf34 mutants for functional characterization:

  • Site-directed mutagenesis: Create specific amino acid substitutions, particularly in the transmembrane domain or proline-rich regions, to assess their impact on localization and function .

  • Domain deletion constructs: Generate truncated forms lacking specific domains (e.g., the transmembrane domain or C-terminal region) to determine their functional significance.

  • N-glycosylation site introduction: As demonstrated in previous research, introduce consensus N-glycosylation sequences (NX(S/T), where X is not proline) to study protein topology and ER targeting .

  • Fluorescent protein fusions: Create C- or N-terminal fusions with fluorescent proteins (such as EGFP) for localization studies, ensuring that the tag does not interfere with proper folding or function .

  • FRB domain fusions: Generate constructs with the FRB domain for inducible interaction studies using the rapamycin system, as previously validated for C4orf34 topology determination .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.