Recombinant Pongo abelii UPF0697 protein C8orf40 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SMIM19; Small integral membrane protein 19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SMIM19
Target Protein Sequence
MAGGYGVMGDDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRRIMRIFSVPPTE ETLSEPNFYDTISKIRLRQQLEMYSISRKYDYQQPQNQADSVQLSLE
Uniprot No.

Target Background

Database Links
Protein Families
SMIM19 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure of the Pongo abelii UPF0697 protein C8orf40 homolog?

The Pongo abelii UPF0697 protein C8orf40 homolog is a 107-amino acid protein derived from Sumatran orangutan. It belongs to the UPF0697 protein family and is homologous to the human C8orf40 protein. The protein contains specific structural motifs that suggest membrane association, as indicated by the hydrophobic regions in its sequence. The full-length protein spans amino acids 1-107 of the expression region .

The protein sequence analysis suggests the presence of a transmembrane domain, with hydrophobic residues (such as those in the sequence "YLIVILVSFGLFMY") potentially forming a membrane-spanning region. This structural characteristic is significant for experimental design, as it may affect solubility and stability in aqueous solutions.

What are the optimal storage conditions for preserving protein stability?

For optimal stability of the Recombinant Pongo abelii UPF0697 protein C8orf40 homolog, the following storage protocol is recommended:

  • Store stock protein at -20°C for regular use

  • For extended storage periods, maintain at -80°C

  • The protein is supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for stability

  • Avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity

  • When working with the protein, prepare working aliquots that can be stored at 4°C for up to one week

This protocol minimizes structural changes and activity loss. If degradation is observed over time (typically manifesting as reduced activity or multiple bands on SDS-PAGE), researchers should prepare fresh working aliquots from the frozen stock.

What methodological approaches are recommended for protein expression studies?

When studying expression patterns of the Pongo abelii UPF0697 protein C8orf40 homolog, researchers should consider complementary approaches:

  • Tissue-specific expression analysis: Similar to approaches used in maternal behavior studies in Pongo abelii, collecting samples across multiple tissue types with biological replicates (minimum n=5) provides robust expression data .

  • Quantitative PCR: Design primers specific to the C8orf40 homolog sequence, avoiding regions of high similarity with other orangutan proteins.

  • Western blotting: Use validated antibodies against conserved epitopes, preferably from regions with minimal post-translational modifications.

  • cDNA microarray analysis: This approach can reveal expression patterns across different physiological conditions, similar to methodologies employed in gene expression studies that identified differentially expressed genes in response to treatments .

When interpreting expression data, researchers should account for biological variability by including samples from multiple individuals and standardizing results against established housekeeping genes appropriate for the tissues being studied.

How can researchers effectively design functional assays for this protein?

Designing effective functional assays for the Pongo abelii UPF0697 protein C8orf40 homolog requires consideration of its predicted properties and potential functions:

  • Membrane interaction assays: Based on the hydrophobic regions in the sequence, examine membrane association using:

    • Liposome binding assays

    • Detergent partition experiments

    • Fluorescence-based membrane insertion studies

  • Protein-protein interaction screening:

    • Yeast two-hybrid with cDNA libraries from relevant Pongo abelii tissues

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID or APEX)

  • Cell-based assays:

    • Transfection studies with tagged constructs to assess subcellular localization

    • CRISPR-mediated knockout to identify phenotypic consequences

    • Overexpression studies to identify gain-of-function effects

When establishing these assays, researchers should include appropriate positive and negative controls, and validate results using complementary methodologies. Given the lack of established functional data for this protein, initial experiments should focus on conserved properties that might be shared with homologous proteins in better-characterized species.

What bioinformatic approaches are recommended for comparative analysis with homologs?

For comparative analysis of the Pongo abelii UPF0697 protein C8orf40 homolog with proteins from other species, researchers should employ a multi-layered bioinformatic approach:

  • Sequence-based analysis:

    • Multiple sequence alignment of homologs across species

    • Phylogenetic tree construction to establish evolutionary relationships

    • Identification of conserved domains and motifs

  • Structural prediction:

    • Secondary structure prediction using algorithms like PSIPRED

    • Tertiary structure modeling using AlphaFold2 or similar tools

    • Comparison of predicted structures with experimental structures of homologs

  • Functional inference:

    • Gene Ontology (GO) term enrichment analysis

    • Pathway analysis of interacting partners

    • Co-expression network analysis

This systematic approach helps researchers identify evolutionarily conserved features that likely represent functional domains, while also highlighting species-specific variations that may relate to functional adaptation. When analyzing results, researchers should consider the evolutionary distance between Pongo abelii and comparison species, accounting for the effects of evolutionary rate variation across different protein domains.

What are common challenges in protein solubility and how can they be addressed?

The hydrophobic regions in the Pongo abelii UPF0697 protein C8orf40 homolog can present solubility challenges. Researchers may encounter these issues and should consider the following solutions:

  • Buffer optimization:

    • Test various pH conditions (typically pH 6.0-8.0)

    • Evaluate different salt concentrations (100-500 mM)

    • Include solubility enhancers like glycerol (10-20%)

    • Consider mild detergents for membrane-associated regions

  • Protein engineering approaches:

    • Express truncated constructs excluding hydrophobic domains

    • Create fusion proteins with solubility tags (MBP, GST, SUMO)

    • Introduce solubility-enhancing mutations in hydrophobic patches

  • Expression conditions:

    • Lower induction temperature (16-18°C)

    • Reduce expression time

    • Use specialized host strains designed for membrane proteins

When troubleshooting solubility issues, systematic documentation of conditions tested and outcomes observed is essential. Small-scale expression and solubility screening should precede larger-scale protein production efforts.

How should researchers address potential cross-reactivity in immunological applications?

When using antibodies targeting the Pongo abelii UPF0697 protein C8orf40 homolog in immunological applications, addressing cross-reactivity concerns requires systematic validation:

  • Antibody validation protocol:

    • Test specificity using recombinant protein as positive control

    • Include lysates from tissues not expressing the target as negative controls

    • Perform peptide competition assays to confirm binding specificity

    • Evaluate cross-reactivity with human C8orf40 and homologs from closely related species

  • Application-specific considerations:

    • For immunohistochemistry: Include isotype controls and pre-immune serum controls

    • For Western blotting: Verify band size and perform knockdown controls when possible

    • For immunoprecipitation: Compare pulldown efficiency with pre-immune controls

  • Data interpretation guidelines:

    • Document all validation experiments systematically

    • Report any observed cross-reactivity in publications

    • Consider multiple antibodies targeting different epitopes for critical experiments

This methodical approach to antibody validation minimizes the risk of misinterpreting results due to cross-reactivity issues, particularly important when working with proteins that have high sequence similarity across species.

What experimental approaches are recommended for investigating protein-protein interactions?

Investigating protein-protein interactions involving the Pongo abelii UPF0697 protein C8orf40 homolog requires a combination of in vitro and cellular approaches:

  • In vitro interaction studies:

    • Pull-down assays using the recombinant protein as bait

    • Surface Plasmon Resonance (SPR) to measure binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Cellular interaction mapping:

    • Proximity-dependent labeling (BioID, APEX)

    • Fluorescence Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

  • High-throughput screening:

    • Yeast two-hybrid screening against orangutan cDNA libraries

    • Protein microarray analysis

    • Affinity purification coupled with mass spectrometry (AP-MS)

When designing these experiments, researchers should consider both stable and transient interactions, as well as the potential impact of post-translational modifications on interaction dynamics. Controls should include known interacting proteins when available, or interactions demonstrated in homologous proteins from other species.

How can researchers effectively design CRISPR-Cas9 experiments to study this protein's function?

When designing CRISPR-Cas9 experiments to study the function of the Pongo abelii UPF0697 protein C8orf40 homolog, researchers should consider:

  • Guide RNA design considerations:

    • Target conserved functional domains

    • Design multiple sgRNAs targeting different exons

    • Validate guide RNA specificity using off-target prediction tools

    • Consider the creation of both knockout and knock-in modifications

  • Cell model selection:

    • Primary cells derived from Pongo abelii when available

    • Human cell lines with high expression of the human ortholog

    • Comparative studies across multiple cell types to identify cell-specific functions

  • Phenotypic analysis:

    • High-content imaging for morphological changes

    • Transcriptomic profiling to identify affected pathways

    • Proteomic analysis to identify changes in interacting partners

    • Functional assays tailored to predicted protein functions

  • Statistical analysis and controls:

    • Use multiple independent clones to account for clonal variation

    • Include rescue experiments to confirm phenotype specificity

    • Implement appropriate statistical tests similar to those used in maternal behavior studies of Pongo abelii

This systematic approach to CRISPR-Cas9 experimental design enables robust functional characterization while minimizing the risk of misinterpreting results due to off-target effects or clonal variation.

What statistical approaches are recommended for analyzing protein expression data?

When analyzing expression data for the Pongo abelii UPF0697 protein C8orf40 homolog, researchers should implement statistical approaches that address biological variability and technical limitations:

  • Normalization strategies:

    • Use multiple reference genes for qPCR data normalization

    • Apply robust normalization methods for microarray data

    • Implement spike-in controls for mass spectrometry-based proteomics

  • Statistical testing framework:

    • For comparing expression across conditions, use methods similar to those employed in maternal behavior studies in Pongo abelii:

      • Linear mixed-effects models for continuous data

      • Generalized linear mixed models for non-normal distributions

      • Include random effects to account for individual variation

  • Multiple testing correction:

    • Apply appropriate multiple testing corrections (Benjamini-Hochberg FDR)

    • Report both uncorrected and corrected p-values

    • Consider effect sizes alongside statistical significance

  • Visualization approaches:

    • Create comprehensive visualizations showing individual data points

    • Include error bars representing variation

    • Present normalized data alongside raw measurements when possible

These statistical approaches ensure robust analysis of expression data, particularly important when working with samples from non-human primates where sample sizes may be limited and individual variation substantial.

How should researchers approach comparative analysis with human orthologs?

When conducting comparative analyses between the Pongo abelii UPF0697 protein C8orf40 homolog and its human ortholog, researchers should implement a systematic framework:

  • Sequence-level comparison:

    • Calculate sequence identity and similarity percentages

    • Identify conserved domains versus divergent regions

    • Map known functional motifs across both sequences

  • Expression pattern comparison:

    • Compare tissue-specific expression profiles

    • Analyze developmental expression patterns when data is available

    • Evaluate expression responses to relevant stimuli

  • Functional conservation assessment:

    • Conduct parallel functional assays in comparable systems

    • Test complementation by expressing orangutan protein in human cell models

    • Evaluate interaction partners for conservation across species

  • Evolutionary analysis framework:

    • Calculate evolutionary rates across different protein domains

    • Identify positively selected residues suggesting functional adaptation

    • Contextualize findings within primate phylogeny

These approaches enable researchers to distinguish between conserved functions that likely represent core biological roles and divergent features that may reflect species-specific adaptations or neutral evolution.

What are the key considerations for using this protein in ELISA-based assays?

When developing ELISA-based assays using the Recombinant Pongo abelii UPF0697 protein C8orf40 homolog, researchers should consider:

  • Assay design parameters:

    • Optimal coating concentration (typically 1-10 μg/ml)

    • Blocking buffer optimization to minimize background

    • Antibody titration to determine optimal working dilutions

    • Detection system selection based on sensitivity requirements

  • Validation requirements:

    • Establish standard curves using purified protein

    • Determine assay dynamic range and lower limit of detection

    • Assess intra-assay and inter-assay variability (CV <15%)

    • Evaluate specificity using related proteins as negative controls

  • Sample preparation considerations:

    • Develop optimized extraction protocols for different sample types

    • Validate recovery using spike-in experiments

    • Account for matrix effects in complex biological samples

  • Data analysis approach:

    • Use appropriate curve-fitting models for standard curves

    • Implement statistical methods to determine confidence intervals

    • Establish acceptance criteria for quality control samples

This methodical approach to ELISA development ensures robust and reproducible results when using the Recombinant Pongo abelii UPF0697 protein C8orf40 homolog for quantitative applications.

How can researchers effectively design domain-specific antibodies for this protein?

Designing domain-specific antibodies for the Pongo abelii UPF0697 protein C8orf40 homolog requires careful epitope selection and validation:

  • Epitope selection strategy:

    • Identify accessible regions using structural predictions

    • Avoid highly conserved regions if species specificity is required

    • Target functional domains for blocking antibodies

    • Consider multiple epitopes from different protein regions

  • Antibody production approach:

    • For monoclonal antibodies: use KLH-conjugated peptides or protein fragments

    • For polyclonal antibodies: immunize with full-length protein and affinity-purify

    • Consider phage display for difficult-to-raise antibodies

  • Validation protocol:

    • Test reactivity against recombinant protein

    • Verify specificity using Western blot, immunoprecipitation

    • Assess cross-reactivity with homologs from related species

    • Confirm epitope mapping using deletion mutants

  • Application-specific optimization:

    • Optimize conditions for each intended application

    • Document working dilutions and optimal conditions

    • Assess lot-to-lot variability for polyclonal antibodies

This systematic approach to antibody development maximizes the likelihood of generating useful reagents for studying the Pongo abelii UPF0697 protein C8orf40 homolog across different experimental contexts.

What are promising research avenues for understanding the function of this protein?

Based on current knowledge about the Pongo abelii UPF0697 protein C8orf40 homolog, several promising research directions emerge:

  • Evolutionary functional analysis:

    • Comparative studies across primate species to identify conserved functions

    • Investigation of selective pressures on specific domains

    • Reconstruction of ancestral sequences to study functional evolution

  • Systems biology approaches:

    • Integration into protein-protein interaction networks

    • Pathway analysis to identify functional contexts

    • Multi-omics profiling following perturbation of expression

  • Structural biology investigations:

    • Determination of three-dimensional structure

    • Analysis of conformational dynamics

    • Structure-function relationship studies

  • Physiological relevance exploration:

    • Tissue-specific knockout studies in model systems

    • Investigation of expression patterns during development

    • Analysis of potential roles in orangutan-specific biology

These research directions build upon available knowledge while addressing fundamental questions about the biological significance of this protein, potentially revealing novel functions and evolutionary adaptations specific to Pongo abelii.

What innovative technologies show promise for studying this protein?

Emerging technologies offer new opportunities for studying the Pongo abelii UPF0697 protein C8orf40 homolog:

  • Advanced imaging approaches:

    • Super-resolution microscopy for subcellular localization

    • Live-cell imaging with fluorescent tags to track dynamics

    • Correlative light and electron microscopy for structural context

  • Single-cell technologies:

    • Single-cell proteomics to study expression heterogeneity

    • Spatial transcriptomics to map expression in tissue context

    • Single-cell functional analysis using CRISPR screens

  • Protein engineering and synthetic biology:

    • Optogenetic control of protein function

    • Biosensors to monitor protein activity in real-time

    • Engineered interaction partners to probe functional domains

  • Computational approaches:

    • AI-driven structure prediction and functional annotation

    • Molecular dynamics simulations to study conformational changes

    • Network-based function prediction algorithms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.