Recombinant Pongo abelii Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

What is VMA21 and what is its primary function in cellular biology?

VMA21 functions as an essential assembly chaperone for the vacuolar ATPase (V-ATPase) complex, the principal mammalian proton pump. The protein is encoded by the VMA21 gene and is critical for the proper assembly of the V-ATPase V0 domain in the endoplasmic reticulum.

In molecular terms, VMA21 is an 8.5-kDa integral membrane protein that spans the membrane twice with both amino and carboxy termini facing the cytosol. It contains a -KKXX ER-retrieval sequence at its carboxy-terminus, suggesting it cycles between the ER and Golgi during V0 subcomplex transport . VMA21 deficiency has been shown to reduce V-ATPase assembly, raise lysosomal pH, and impair autophagic processes .

How does the structure of Pongo abelii VMA21 compare to human VMA21?

Pongo abelii (Sumatran orangutan) VMA21 shares high sequence homology with human VMA21. While specific structural differences aren't fully characterized in the literature, both proteins maintain the core functional domains necessary for V-ATPase assembly.

The recombinant Pongo abelii VMA21 protein available for research applications is typically produced using cell-free expression systems with greater than 85% purity as determined by SDS-PAGE . This high conservation makes Pongo abelii VMA21 a valuable model for studying human VMA21 function, especially in comparative evolutionary studies examining V-ATPase assembly mechanisms across primate species.

Which experimental models are most suitable for studying VMA21 function?

Several experimental models have proven effective for studying VMA21 function:

• Yeast models: As VMA21 was first characterized in Saccharomyces cerevisiae (where it's called Vma21p), yeast remains a powerful model for basic functional studies and genetic manipulations .

• Fibroblast cultures: Patient-derived fibroblasts have been instrumental in characterizing human VMA21 mutations. Studies show fibroblasts can demonstrate reduced VMA21 transcripts (at 40% of normal) and protein levels .

• Zebrafish models: Recently developed CRISPR-Cas9 engineered zebrafish with loss-of-function mutations in vma21 effectively phenocopy human disease with impaired motor function, survival issues, liver dysfunction, and dysregulated autophagy .

The zebrafish model specifically demonstrated:

• Lysosomal de-acidification

• Characteristic autophagic vacuoles in muscle fibers

• Altered autophagic flux

• Reduced lysosomal marker staining

When selecting a model, researchers should consider that species-specific differences in VMA21 function exist, particularly in regulatory pathways and interacting partners.

What expression systems are optimal for producing recombinant Pongo abelii VMA21 protein?

Several expression systems have been successfully used for recombinant VMA21 production, each with specific advantages:

• Cell-free expression systems: Most commonly used for Pongo abelii VMA21 production, achieving greater than 85% purity as determined by SDS-PAGE . This system avoids difficulties associated with expressing membrane proteins in cellular systems.

• E. coli: Can be used for producing recombinant VMA21, though optimization may be needed for this integral membrane protein. For example, recombinant Danio rerio VMA21 has been successfully expressed in E. coli with an N-terminal His tag .

• Mammalian cell expression: Offers proper folding and post-translational modifications, crucial for functional studies. Human VMA21 has been successfully expressed in mammalian cells with >80% purity .

• Yeast and baculovirus systems: Alternative expression systems that may be suitable depending on experimental requirements .

For functional studies, mammalian expression systems are preferred as they provide the cellular machinery necessary for proper membrane protein folding and trafficking.

What are the most effective purification strategies for recombinant VMA21 protein?

Purifying recombinant VMA21 presents challenges due to its nature as a small integral membrane protein. Recommended purification strategies include:

• Affinity chromatography: His-tagged VMA21 can be purified using nickel or cobalt affinity resins. To distinguish full-length proteins from truncated products, use fusion tags on both ends and increase imidazole concentration during elution .

• Size exclusion chromatography: Useful as a secondary purification step to achieve >85% purity and separate protein aggregates.

• Detergent optimization: Critical for membrane protein solubilization while maintaining native conformation. Common detergents include n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations determined through empirical testing.

• Buffer optimization: PBS-based buffers with 6% trehalose at pH 8.0 have been used successfully for storage , but optimal conditions should be determined experimentally for each preparation.

For quality control, SDS-PAGE analysis should be performed to confirm purity (>85%) and western blotting to verify identity. For applications requiring higher purity, additional chromatography steps may be necessary.

How can researchers verify the functional integrity of recombinant VMA21?

Verifying functional integrity of recombinant VMA21 requires multiple complementary approaches:

• Co-immunoprecipitation assays: Functional VMA21 should interact with V-ATPase V0 subunits. Immunoprecipitation of wild-type VMA21 has been shown to co-precipitate all five V0 subunits . A working assay should demonstrate:

  • Interaction with ATP6V0D1 and ATP6V0C subunits

  • Interaction with assembly factor ATP6AP2

• V-ATPase assembly analysis: Western blot analysis can determine if VMA21 properly facilitates V-ATPase assembly by examining:

  • Steady-state levels of V1 subunits ATP6V1D1 and ATP6V1B1/2 (should remain unaffected)

  • Expression of V0 subunits ATP6V0D1 and ATP6V0C (reduced in defective VMA21)

• Functional rescue experiments: Complementation of VMA21-deficient cells with recombinant protein should restore:

  • Proper lysosomal pH (measured using pH-sensitive fluorescent probes)

  • Autophagy function

  • Normal levels of V0 subunit expression

• Protein-protein interaction studies: Transient transfection of tagged VMA21 constructs in HEK293T cells can be used to compare binding capacity to ATP6AP2 and ATP6V0C between wild-type and mutant forms .

How do mutations in VMA21 contribute to X-linked Myopathy with Excessive Autophagy (XMEA)?

VMA21 mutations causing XMEA operate through a specific pathogenic mechanism:

• Primary defect: Mutations (often hypomorphic alleles) reduce VMA21 protein levels, impairing V-ATPase assembly. This has been demonstrated in patient-derived fibroblasts showing reduced VMA21 transcript levels at approximately 40% of normal expression .

• Cellular consequences:

  • Impaired V-ATPase function raises lysosomal pH

  • Reduced lysosomal degradative ability blocks autophagy

  • Decreased cellular free amino acids leads to mTORC1 pathway downregulation

  • This triggers increased macroautophagy as compensation

  • Formation of large, ineffective autolysosomes that engulf cytoplasm, merge, and cause cellular vacuolation

• Genotype-phenotype correlations: The severity of the XMEA phenotype correlates with residual VMA21 expression levels. Classical XMEA patients display VMA21 mRNA levels at 42-69% of normal expression, while more severe phenotypes correspond to greater reductions (~22-25% of normal) .

• Molecular pathology: Muscle biopsies show characteristic vacuolation with sarcolemmal features and basement membrane components, reflecting the accumulation of autophagic material in lysosomes.

This represents a novel disease mechanism described as "macroautophagic overcompensation leading to cell vacuolation and tissue atrophy" .

What experimental approaches can be used to study VMA21 splicing defects in disease models?

Several approaches have proven effective for studying VMA21 splicing defects, particularly intronic mutations affecting splicing efficiency:

These approaches have successfully characterized intronic VMA21 mutations, such as the c.164-20T>A variant, which was shown to impact splicing efficiency through intron retention, leading to reduced VMA21 transcript and protein levels .

How does VMA21 dysfunction affect autophagy and lysosomal function in different tissue types?

VMA21 dysfunction affects autophagy and lysosomal function through a cascade of events that can manifest differently across tissues:

• Skeletal muscle (primary affected tissue in XMEA):

  • Characteristic autophagic vacuoles in muscle fibers

  • Progressive vacuolation and atrophy

  • Proximal muscle weakness with onset typically in childhood

  • Elevated creatine kinase levels (e.g., 1385 IU/L in one patient)

• Liver (affected in VMA21-related congenital disorder of glycosylation):

  • Mild cholestasis

  • Chronic elevation of aminotransferases

  • Elevation of LDL cholesterol

  • Hepatocyte steatosis

• Cellular mechanisms (studied in fibroblasts and other models):

  • Raised lysosomal pH due to V-ATPase dysfunction

  • Reduced lysosomal degradative capacity

  • Blocked autophagy

  • Decreased cellular free amino acids

  • Downregulation of mTORC1 pathway

  • Compensatory increase in macroautophagy

  • Formation of large, ineffective autolysosomes

• Zebrafish model findings:

  • Impaired motor function (measurable through touch-evoked escape response)

  • Reduced survival

  • Liver dysfunction

  • Lysosomal de-acidification

  • Altered autophagic flux

  • Reduced lysosomal marker staining

These tissue-specific manifestations highlight the critical role of proper V-ATPase function in cellular homeostasis, particularly in tissues with high energy demands or specialized lysosomal functions.

How can VMA21 protein interactions be leveraged to study V-ATPase assembly mechanisms?

VMA21 protein interactions provide a valuable window into V-ATPase assembly mechanisms and can be studied through several approaches:

• Co-immunoprecipitation studies: Immunoprecipitation of VMA21 from wild-type membranes results in co-precipitation of all five V0 subunits, demonstrating its role in V0 assembly. This technique can be used to:

  • Map specific interaction domains

  • Identify novel binding partners

  • Examine how mutations affect protein interactions

• Protein-protein interaction analysis of mutant forms:

  • Transient transfection of Myc-tagged VMA21 constructs (wild-type and variants like R18G, D63G, G91A)

  • Comparison of binding capacity to assembly factors (ATP6AP2) and V0 subunits (ATP6V0C)

  • Western blot analysis to quantify interaction strength

• Domain mapping studies: The -KKXX ER-retrieval sequence at VMA21's carboxy-terminus suggests it cycles between the ER and Golgi. Mutation of this motif to -QQXX leads to mislocalization to the vacuolar membrane but, interestingly, still allows V-ATPase assembly function .

• V-ATPase assembly analysis through western blotting:

  • V1 domain assembly (cytosolic) occurs independently of VMA21

  • V0 domain assembly (membrane-integrated) requires VMA21

  • Analysis of steady-state levels of various subunits can map the assembly pathway

These approaches have revealed that VMA21 plays a critical role specifically in V0 domain assembly, while the V1 domain assembles independently in the cytosol.

What comparative approaches can reveal evolutionary conservation of VMA21 function across species?

Evolutionary conservation of VMA21 can be studied through several comparative approaches:

• Phylogenetic analysis: VMA21 has been studied across multiple species including:

  • Saccharomyces cerevisiae (Vma21p)

  • Humans (VMA21)

  • Danio rerio (vma21)

  • Pongo abelii (VMA21)

  • Multiple other species including Xenopus tropicalis, Drosophila melanogaster, and various fungi

• Sequence alignment and conservation analysis:

  • The core functional domains of VMA21 are highly conserved

  • The amino acid sequence for zebrafish VMA21 (1-104 aa) is: MQNYDKKEVGSVPGAMPDFRGNDGSLVSVLKTLLFFTILMITLPIGLYFTSKSLLFEATL GYSSNDSYFYAAILAVLAVHVVLALFVYVAWNEGSRQWREGKQD

  • Comparative analyses can identify conserved motifs critical for function

• Statistical testing of evolutionary hypotheses:

  • Shimodaira-Hasegawa (SH) test can determine if gene phylogenies differ significantly from species phylogenies

  • Models of codon evolution (ω, ratio of nonsynonymous to synonymous substitutions) can estimate selection pressure across the protein

• Functional complementation studies:

  • Testing whether VMA21 from one species can rescue defects in another

  • Cross-species protein interaction studies to identify conserved binding partners

• Comparative disease modeling:

  • Zebrafish vma21 mutants phenocopy human XMEA disease

  • Touch-evoked escape response testing provides a quantifiable behavioral readout in the zebrafish model

These approaches reveal that VMA21 function in V-ATPase assembly is highly conserved, though regulatory mechanisms may differ between species.

What therapeutic strategies could target VMA21-related pathways in treating XMEA or related disorders?

Emerging therapeutic strategies targeting VMA21-related pathways include:

• Small molecule interventions:

  • Edaravone and LY294002 have shown promise in a zebrafish model, improving swim behavior and survival

  • These compounds likely act by modulating autophagy pathways downstream of VMA21 dysfunction

• Autophagy modulation strategies:

  • Since excessive autophagy contributes to pathology, autophagy inhibitors might ameliorate symptoms

  • Conversely, enhancing lysosomal function might improve clearance of accumulated material

• Gene therapy approaches:

  • Delivery of functional VMA21 gene to affected tissues

  • CRISPR-based editing to correct specific mutations

  • For splicing mutations (like c.164-20T>A), antisense oligonucleotides might improve splicing efficiency

• mTORC1 pathway modulation:

  • VMA21 deficiency leads to downregulation of the mTORC1 pathway

  • mTORC1 activators might counteract the compensatory increase in macroautophagy

• V-ATPase enhancement:

  • Compounds that stabilize partially assembled V-ATPase complexes

  • Chaperones that could substitute for VMA21 function

• Experimental assessment methods:

  • In zebrafish models, therapeutic efficacy can be measured via:

    • Touch-evoked escape response categories (low/none, medium, high responders)

    • Survival analysis using Kaplan-Meier method

    • Pigmentation and morphological assessment

These approaches represent promising avenues for developing treatments for XMEA and related disorders caused by VMA21 dysfunction, though all require further investigation to establish clinical efficacy.

What are the key challenges in detecting and quantifying VMA21 protein levels in experimental systems?

Detecting and quantifying VMA21 presents several technical challenges:

• Protein size and characteristics:

  • VMA21 is a small (8.5-kDa) integral membrane protein

  • It spans the membrane twice with both termini facing the cytosol

  • These properties make it difficult to extract, detect, and quantify using standard methods

• Antibody limitations:

  • Limited availability of specific antibodies for VMA21 from different species

  • Cross-reactivity issues between closely related species

  • Verification of antibody specificity is essential through knockout/knockdown controls

• Protein extraction challenges:

  • As an integral membrane protein, VMA21 requires careful optimization of detergent conditions

  • Incomplete solubilization may lead to underestimation of protein levels

  • Appropriate controls (loading controls like α-tubulin and histone H4) are necessary

• Quantification methods:

  • Western blotting with chemiluminescence detection provides semi-quantitative results

  • More precise quantification requires fluorescence-based western blotting or ELISA methods

  • Mass spectrometry-based approaches may be necessary for absolute quantification

• mRNA vs. protein correlation:

  • VMA21 mutations affecting splicing may show discrepancies between mRNA and protein levels

  • Both RT-qPCR for transcript quantification and western blotting for protein levels should be performed

These challenges necessitate careful experimental design and validation of methodologies when studying VMA21 expression and function.

How can researchers effectively design mutation studies to investigate VMA21 structure-function relationships?

Effective mutation studies for VMA21 structure-function analysis should follow these methodological principles:

• Mutation selection strategy:

  • Target conserved residues identified through multi-species alignment

  • Focus on disease-associated variants (e.g., R18G, D63G, G91A)

  • Include the -KKXX ER-retrieval sequence motif at the carboxy-terminus, as modification to -QQXX affects localization but preserves function

• Expression system considerations:

  • Transient transfection in HEK293T cells has been successful for protein-protein interaction studies

  • For membrane protein expression, mammalian systems may provide more physiologically relevant results than bacterial systems

  • Include appropriate tags (e.g., Myc-tag) that don't interfere with protein function

• Functional assays:

  • Co-immunoprecipitation to assess interaction with ATP6AP2 and ATP6V0C

  • Western blot analysis of V0 subunit levels to evaluate assembly function

  • Subcellular localization studies using immunofluorescence

  • V-ATPase activity assays measuring proton transport or ATP hydrolysis

• Rescue experiments:

  • Complementation of VMA21-deficient cells (patient-derived or CRISPR-engineered)

  • Measurement of lysosomal pH using ratiometric probes

  • Assessment of autophagy markers (LC3-II, p62)

  • Analysis of mTORC1 pathway activation

• Controls and validation:

  • Include wild-type VMA21 as positive control

  • Use empty vector as negative control

  • Verify comparable expression levels of all mutant constructs

  • Consider second-site suppressor mutations to validate specific interaction mechanisms

These approaches have successfully characterized mutations affecting VMA21 function and can be applied to further structure-function studies.

What considerations are important when comparing VMA21 function across different model systems?

When comparing VMA21 function across different model systems, researchers should consider:

• Evolutionary divergence:

  • VMA21 function is conserved from yeast to humans, but sequence identity varies

  • The yeast ortholog (Vma21p) and human VMA21 both function as V-ATPase assembly chaperones despite divergence

  • Consider using models within closer evolutionary distance for specific aspects (e.g., Pongo abelii for human disease modeling)

• Isoform diversity:

  • The human VMA21 gene encodes three different transcripts, with only two predicted to be translated into proteins (101- and 156-amino-acid long)

  • Expression patterns of these isoforms vary across tissues and cell types

  • Ensure the correct isoform is being studied in each model system

• Tissue-specific effects:

  • VMA21 mutations cause primarily myopathic phenotypes in XMEA but have been linked to liver disease in other contexts

  • Zebrafish vma21 mutants show both muscle and liver phenotypes

  • Cell-type specific factors may influence phenotypic expression

• Model-specific readouts:

  • In zebrafish, touch-evoked escape response provides a quantifiable behavioral metric

  • In cell culture, V-ATPase assembly can be directly assessed by biochemical means

  • In patient samples, clinical severity correlates with residual VMA21 expression levels

• Experimental variables:

  • Different expression systems (E. coli, yeast, baculovirus, mammalian cells) may affect protein folding and function

  • Cell-free expression systems may lack post-translational modifications or membrane insertion capacity

  • Experimental conditions should be standardized when making cross-model comparisons

Acknowledging these differences is crucial for proper experimental design and interpretation of results when studying VMA21 across different model systems.

How should researchers interpret variations in VMA21 expression levels in experimental and clinical samples?

Interpreting VMA21 expression variations requires consideration of several factors:

• Baseline expression variation:

  • VMA21 expression varies naturally across tissues, with fibroblasts showing enriched expression

  • The VMA21-201 transcript is the most abundant in fibroblasts according to GTEx data

  • Establish appropriate tissue-specific reference ranges

• Pathological significance thresholds:

  • Classical XMEA patients display VMA21 mRNA levels at 42-69% of normal expression

  • Severe phenotypes correspond to levels at 22-25% of normal expression

  • Patient-derived fibroblasts with intronic mutations show reduction to approximately 40% of normal levels

  • These percentages provide benchmarks for interpreting experimental results

• Technical considerations:

  • Normalize to appropriate housekeeping genes that remain stable in the condition being studied

  • For protein quantification, use loading controls like α-tubulin and histone H4

  • Consider both transcript and protein levels, as post-transcriptional regulation may occur

• Statistical analysis:

  • Apply appropriate statistical tests based on sample distribution (e.g., one-way ANOVA, two-way ANOVA)

  • Report significance levels (e.g., p < 0.0001) and include error bars in graphical representations

  • Consider biological versus technical replication in study design

• Clinical correlation:

  • Correlate expression levels with clinical severity metrics

  • Consider functional measures (e.g., muscle strength scores, creatine kinase levels)

  • Account for potential confounding factors in patient samples

These guidelines facilitate proper interpretation of VMA21 expression data in both research and clinical contexts.

What analytical approaches best characterize the impact of VMA21 on V-ATPase assembly and function?

Optimal analytical approaches for characterizing VMA21's impact on V-ATPase include:

• Biochemical assessment of V-ATPase assembly:

  • Western blot analysis of V1 (ATP6V1D1, ATP6V1B1/2) and V0 (ATP6V0D1, ATP6V0C) subunits

  • Co-immunoprecipitation studies to identify interacting partners

  • Blue native PAGE to assess intact complex formation

  • Sucrose gradient centrifugation to separate assembled complexes

• Functional V-ATPase assays:

  • Lysosomal pH measurement using ratiometric fluorescent probes

  • ATP hydrolysis activity assays

  • Proton transport measurements in reconstituted vesicles

  • Organelle acidification in intact cells

• Quantitative data analysis:

  • Densitometry of western blots to quantify protein levels

  • Ratiometric analysis of V0:V1 subunit expression

  • Statistical comparison between wild-type and mutant conditions

  • Dose-response relationships between VMA21 levels and V-ATPase function

• Microscopy-based approaches:

  • Immunofluorescence co-localization studies

  • Live-cell imaging of fluorescently tagged subunits

  • Super-resolution microscopy to visualize assembly intermediates

  • Electron microscopy to examine autophagosome and lysosome morphology

• Genetic interaction studies:

  • Epistasis analysis with other V-ATPase assembly factors

  • Synthetic genetic array analysis in model organisms

  • CRISPR screens to identify genetic modifiers

These complementary approaches provide a comprehensive assessment of how VMA21 impacts V-ATPase assembly and function, allowing researchers to build mechanistic models of both normal physiology and disease states.

How can multi-omics approaches enhance our understanding of VMA21-related pathways and potential therapeutic targets?

Multi-omics approaches offer powerful strategies for understanding VMA21-related pathways:

• Transcriptomics integration:

  • RNA-seq analysis of VMA21-deficient models can identify dysregulated pathways

  • Alternative splicing analysis can detect changes in transcript isoforms

  • Single-cell RNA-seq can reveal cell type-specific responses to VMA21 dysfunction

  • Splicing analysis is particularly relevant given the importance of intronic mutations in VMA21 pathology

• Proteomics applications:

  • Quantitative proteomics can identify changes in protein abundance and post-translational modifications

  • Proximity labeling approaches (BioID, APEX) can map the VMA21 interactome

  • Thermal proteome profiling can identify proteins stabilized by VMA21 interaction

  • Phosphoproteomics can reveal signaling changes downstream of mTORC1 dysregulation

• Metabolomics insights:

  • Analysis of amino acid pools, as VMA21 deficiency reduces cellular free amino acids

  • Lipidomics to detect changes in membrane composition affecting V-ATPase function

  • Metabolic flux analysis to measure autophagic degradation rates

• Integrative analysis frameworks:

  • Pathway enrichment analysis to identify affected cellular processes

  • Network analysis to map connections between dysregulated components

  • Machine learning approaches to identify biomarkers or therapeutic targets

  • Systems biology modeling of V-ATPase assembly and autophagic processes

• Translational applications:

  • Drug repurposing through correlation of transcriptional signatures

  • Identification of small molecules that restore VMA21 function or compensate for its loss

  • Patient stratification based on multi-omics profiles

  • Pharmacogenomic prediction of treatment response