Recombinant Pongo abelii Vezatin (VEZT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
VEZT; Vezatin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-731
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
VEZT
Target Protein Sequence
MLKEWAIKQGILLKVAETIKSWIFFSQCNKKDDLLHKLDIGFRLDSLHTILQQEVLLQED VELIELLDPSILSAGQSQQQENGHLPTLCSLATPNIWDLSMLFAFISLLVMLPTWWIVSS WLVWGVILFVYLVIRALRLWRTAKLQVTLKKYSVHLEDMATNSRAFTNLVRKALRLIQET EVISRGFTLVSAACPFNKAGQHPSQHLIGLRKAVYRTLRANFQAARLATLYMLKNYPLNS ESDNVTNYICVVPFKELGLGLSEEQISEEEAHNFTDGFSLPALKVLFQLWVAQSSEFFRR LALLLSTTNSPPGPLLTPALLPHRILSDVTQGLPHAHSACLEELKRSYEFYRYFETQHQS VPQCLSKTQQKSRELNNVHTAVRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAY PILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPT LHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKLEHEESKRVLQELKS VLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEPSMNSDMGKVSKNDTEEES SKSTTTDNEISRTEYLCENSLEGKNKDNSSNEVFRQGAEERMCYQCESEDEPQADGSGLT TAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGDEEEEQI IEENKNKIEEK
Uniprot No.

Target Background

Function
Recombinant Pongo abelii Vezatin (VEZT) plays a crucial role in the formation and maintenance of adherens junctions throughout life. It is essential for preimplantation embryo morphogenesis and the implantation process.
Database Links
Protein Families
Vezatin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, stereocilium membrane. Cell junction, adherens junction. Nucleus. Cytoplasmic vesicle, secretory vesicle, acrosome.

Q&A

What is Vezatin (VEZT) and what are its primary functions in Pongo abelii?

Vezatin (VEZT) is a protein involved in multiple cellular processes, most notably as a conserved regulator of retrograde axonal transport. In vertebrates, including Pongo abelii (Sumatran orangutan), Vezatin is required for the maturation and maintenance of cell-cell junctions . Recent research has expanded our understanding of its functions to include specific roles in the retrograde transport of endosomes and other cellular cargo in neurons . The full-length Vezatin protein spans amino acids 1-731 and contains multiple functional domains that facilitate its various cellular interactions .

To study this protein's function, researchers typically use recombinant expression systems to produce the protein for further characterization or develop genetic models with modified VEZT expression. Comparative studies between species have revealed that Vezatin's role in axonal transport is evolutionarily conserved from fungi to vertebrates, making it an excellent model for understanding fundamental cellular transport mechanisms .

How does Pongo abelii Vezatin compare structurally to human Vezatin?

Pongo abelii (Sumatran orangutan) Vezatin shares high sequence homology with human Vezatin, making it a valuable model for studying human neurological processes. The protein is characterized by:

FeaturePongo abelii VezatinHuman VezatinSignificance
Length731 amino acids734 amino acidsHigh structural conservation
Sequence identityReference (Q5RFL7)~98% identicalFunctional domains preserved
Key domainsTransmembrane domain, cytoplasmic regionSame arrangementConservation of binding interfaces
Post-translational modificationsMultiple phosphorylation sitesSimilar sitesRegulatory mechanisms likely conserved

The high degree of conservation between orangutan and human Vezatin suggests that findings from studies using Pongo abelii VEZT can be reasonably extrapolated to human systems . When designing experiments, researchers should consider that while the core functions are likely identical, there may be subtle species-specific differences in interaction partners or regulatory mechanisms.

What experimental models are most appropriate for studying Vezatin function?

Based on recent findings, several model systems have proven effective for investigating Vezatin functions:

  • Drosophila models: Studies using Drosophila have identified vezatin-like (vezl) gene functions through loss-of-function mutations. These models are particularly useful for studying the role of Vezatin in endosome transport and BMP receptor signaling in motor neurons .

  • Zebrafish models: Disruption of vezt in zebrafish has demonstrated its specific role in the retrograde axonal transport of late endosomes. This model is valuable for real-time visualization of transport processes in intact organisms .

  • Cell culture systems: Recombinant Vezatin protein can be used in cell culture models to study specific protein-protein interactions and cellular localization patterns .

For most comprehensive research, a multi-model approach is recommended, combining in vitro biochemical studies with appropriate in vivo models. This provides both molecular detail and physiological relevance to the findings.

What are the optimal storage and handling conditions for recombinant Pongo abelii Vezatin?

Proper storage and handling of recombinant Vezatin is critical for maintaining its structural integrity and functional activity. Based on standard protocols for this protein:

ConditionRecommendationRationale
Storage temperature-20°C for routine storage; -80°C for long-termPrevents protein degradation and maintains activity
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Working aliquotsStore at 4°C for up to one weekMinimizes freeze-thaw cycles
Freeze-thaw cyclesAvoid repeated freezing and thawingPrevents protein denaturation and aggregation
Working concentrationExperiment-dependent (typically 0.1-1 μg/ml)Ensures optimal signal-to-noise ratio in assays

When designing experiments, it's advisable to prepare single-use aliquots of the protein to avoid repeated freeze-thaw cycles that can compromise protein quality. For applications requiring native protein conformation, verify protein integrity via SDS-PAGE or functional assays before proceeding with complex experiments .

How can researchers effectively design co-immunoprecipitation experiments to identify Vezatin interaction partners?

Co-immunoprecipitation (Co-IP) is a valuable technique for identifying novel Vezatin interaction partners, particularly in the context of axonal transport. A methodological approach would include:

  • Antibody selection: Use high-specificity antibodies against Vezatin or epitope-tagged recombinant versions. For Pongo abelii Vezatin specifically, consider using antibodies that recognize conserved epitopes between primate species.

  • Cell/tissue preparation: Based on the research focus, prepare lysates from:

    • Neuronal cultures to study axonal transport interactions

    • Cell junction-rich tissues to study adhesion complex interactions

    • Transfected cells expressing recombinant Vezatin

  • Control considerations:

    • Use IgG controls to identify non-specific binding

    • Include vezatin-null or knockdown samples as negative controls

    • Consider both native conditions and crosslinking approaches to capture transient interactions

  • Validation strategy:

    • Confirm interactions with reciprocal Co-IPs

    • Validate with orthogonal methods (proximity ligation, FRET)

    • Perform functional assays to confirm biological relevance of interactions

Researchers should focus particularly on dynein complex components and adaptor proteins, as Vezatin's role in retrograde transport suggests these are likely physiological interaction partners .

What approaches are recommended for studying Vezatin's role in retrograde axonal transport?

To investigate Vezatin's function in retrograde axonal transport, researchers should consider these methodological approaches:

  • Live imaging of cargo transport:

    • Express fluorescently-tagged cargo markers in neurons (late endosomes, signaling endosomes, dense core vesicles)

    • Use time-lapse microscopy to track movement in wild-type and Vezatin-deficient neurons

    • Quantify transport parameters (velocity, frequency, run length, directional bias)

  • Cargo accumulation assays:

    • Examine accumulation of specific cargoes in axon terminals following Vezatin disruption

    • Use immunofluorescence to detect endogenous cargoes in fixed samples

    • Utilize pulse-chase experiments with endocytic markers

  • Biochemical interaction studies:

    • Identify interactions between Vezatin and transport machinery components

    • Map domains responsible for cargo recognition versus motor protein recruitment

    • Determine if interactions are direct or require adaptor proteins

  • Functional recovery experiments:

    • Test if transport defects can be rescued by expressing wild-type Vezatin

    • Use domain mutants to determine which regions are critical for function

    • Compare rescue efficiency between different species' Vezatin proteins

The methodology should be adapted based on specific research questions, focusing particularly on cargo selectivity, as Vezatin appears to regulate transport of some cargoes (endosomes, dense core vesicles) but not others (mitochondria) .

How can researchers utilize Vezatin to study neurological disorders associated with axonal transport defects?

Axonal transport defects are implicated in various neurodegenerative conditions. Vezatin's specific role in retrograde transport makes it a valuable target for studying these disorders:

  • Disease model development:

    • Generate conditional Vezatin knockout models in specific neuronal populations

    • Create knockin models expressing disease-associated Vezatin variants

    • Develop iPSC-derived neuronal models from patients with transport-related disorders

  • Mechanistic investigations:

    • Examine how Vezatin dysfunction affects neurotrophin signaling pathways

    • Investigate potential accumulation of toxic proteins when retrograde transport is compromised

    • Study the long-term consequences of selective transport defects on neuronal health

  • Therapeutic screening approaches:

    • Use Vezatin-deficient models to screen compounds that might restore transport

    • Identify small molecules that could enhance remaining Vezatin function

    • Develop targeted approaches to bypass Vezatin by directly activating transport machinery

  • Biomarker development:

    • Assess whether Vezatin levels or post-translational modifications correlate with disease progression

    • Investigate if Vezatin dysfunction leads to measurable changes in accessible biofluids

The selective nature of Vezatin's transport regulation (affecting endosomes but not mitochondria) provides an opportunity to dissect cargo-specific contributions to neurodegeneration, which could lead to more targeted therapeutic approaches .

What are the current approaches for investigating the evolutionary conservation of Vezatin function across species?

The evolutionary conservation of Vezatin from fungi to vertebrates presents unique research opportunities:

  • Comparative genomic analysis:

    • Align Vezatin sequences across diverse species (fungal VezA, Drosophila vezl, zebrafish vezt, Pongo abelii VEZT, human VEZT)

    • Identify highly conserved domains versus species-specific regions

    • Construct phylogenetic trees to trace functional divergence

  • Cross-species functional complementation:

    • Test if human Vezatin can rescue function in Drosophila vezl mutants

    • Express domain chimeras to identify functionally conserved regions

    • Determine which aspects of function are universally conserved versus species-specific

  • Comparative interactome mapping:

    • Identify Vezatin interaction partners across model systems

    • Determine conservation of protein complexes involved in transport

    • Compare post-translational modification patterns that regulate function

  • Experimental evolutionary approaches:

    • Reconstruct ancestral Vezatin sequences to test ancient function

    • Identify selection pressures that shaped modern Vezatin proteins

    • Study how Vezatin adapted to different cellular contexts across evolution

This evolutionary approach can reveal fundamental mechanisms of retrograde transport that have been preserved through hundreds of millions of years of evolution, highlighting essential functional domains that might be targets for therapeutic intervention in transport-related disorders .

How might researchers investigate the cargo-specificity mechanisms of Vezatin in retrograde transport?

Understanding how Vezatin selectively regulates transport of specific cargoes is a frontier research question:

  • Cargo recognition domain mapping:

    • Create a series of Vezatin truncation and point mutants

    • Test each variant's ability to rescue transport of different cargoes

    • Identify domains specifically required for endosome versus dense core vesicle transport

  • Interaction proteomics approaches:

    • Perform BioID or proximity labeling experiments using Vezatin as bait

    • Compare interactomes when different cargoes are being actively transported

    • Identify cargo-specific adaptor proteins that might mediate selectivity

  • Structural biology investigations:

    • Determine crystal or cryo-EM structures of Vezatin bound to different cargo adaptors

    • Identify binding interfaces that confer specificity

    • Use structural information to design mutations that selectively disrupt specific cargo interactions

  • Real-time observation of cargo selection:

    • Develop biosensors to detect Vezatin-cargo interactions in living cells

    • Use multi-channel live imaging to simultaneously track Vezatin and different cargoes

    • Analyze the temporal sequence of Vezatin recruitment to different cargo types

This research direction could reveal fundamental principles about how transport selectivity is achieved within neurons, with implications for understanding both normal neuronal function and pathological conditions .

What are common challenges when working with recombinant Vezatin and how can they be overcome?

Researchers working with recombinant Pongo abelii Vezatin often encounter several technical challenges:

  • Protein solubility issues:

    • Problem: Recombinant Vezatin may aggregate or show poor solubility

    • Solution: Optimize expression conditions (lower temperature, modified induction protocols); use solubility tags; test different buffer compositions with varying salt concentrations and pH

  • Functional activity assessment:

    • Problem: Confirming whether recombinant Vezatin retains native functionality

    • Solution: Develop activity assays based on known functions (e.g., binding to transport machinery components); compare wild-type to known non-functional mutants; validate with cellular assays

  • Specificity of interactions:

    • Problem: Distinguishing true interacting partners from non-specific binding

    • Solution: Include appropriate negative controls; perform competition assays; validate interactions through multiple methodologies

  • Storage stability:

    • Problem: Loss of activity during storage

    • Solution: Add stabilizing agents (glycerol, reducing agents); prepare single-use aliquots; validate protein activity before critical experiments

For researchers working with the full-length protein (731 amino acids), expression of smaller functional domains might provide a more tractable approach for certain applications, particularly when investigating specific interaction interfaces.

How can researchers differentiate between direct and indirect effects when studying Vezatin knockout phenotypes?

When interpreting phenotypes from Vezatin disruption experiments, distinguishing direct from indirect effects is crucial:

  • Acute versus chronic disruption comparison:

    • Use inducible knockout/knockdown systems to observe immediate effects

    • Compare with constitutive knockout models to identify secondary adaptations

    • Employ temporally controlled rescue experiments to determine reversibility of phenotypes

  • Domain-specific disruption:

    • Create mutants that disrupt specific functions rather than eliminating the entire protein

    • Use structure-function correlations to predict and test specific interaction interfaces

    • Compare phenotypes of different functional mutants to dissect mechanism

  • Cell-autonomous versus non-autonomous effects:

    • Use mosaic models with labeled cells to assess if effects are restricted to Vezatin-deficient cells

    • Perform cell type-specific knockouts to determine primary affected populations

    • Use co-culture systems to assess intercellular effects

  • Temporal analysis of phenotype progression:

    • Document the sequence of cellular and molecular changes following Vezatin disruption

    • Identify the earliest detectable phenotypes as likely direct effects

    • Map the cascade of events to understand causal relationships

This methodological approach is particularly important given Vezatin's dual roles in cell junction maintenance and axonal transport, as disruption of either function could indirectly affect the other .

What controls and validations are essential when studying the specific role of Vezatin in cargo transport?

  • Specificity controls for cargo effects:

    • Examine multiple cargo types, including those affected (endosomes, dense core vesicles) and unaffected (mitochondria) by Vezatin loss

    • Quantify parameters for both retrograde and anterograde transport to confirm directional specificity

    • Use multiple independent markers for each cargo type to ensure representative sampling

  • Genetic controls:

    • Use multiple independent Vezatin disruption methods (CRISPR knockout, RNAi, dominant negative)

    • Perform rescue experiments with wild-type Vezatin to confirm specificity

    • Include heterozygous models to assess dosage sensitivity

  • Technical validations:

    • Blind analysis of transport parameters to prevent bias

    • Standardize imaging and analysis parameters across experimental groups

    • Use automated tracking software with manual verification of tracks

  • Physiological relevance validation:

    • Correlate transport defects with functional outcomes (synapse maintenance, neuron survival)

    • Compare effects across different neuronal types to assess cell type specificity

    • Validate in vivo findings with complementary in vitro approaches

This rigorous approach ensures that observed phenotypes can be confidently attributed to Vezatin's specific role in retrograde transport, rather than to experimental artifacts or secondary consequences of its disruption .

What are the most promising future research directions for Vezatin in neurological disease contexts?

Based on current knowledge of Vezatin function, several promising research directions emerge:

  • Neurodegenerative disease connections:

    • Investigate Vezatin expression and function in Alzheimer's, Parkinson's, and ALS models

    • Determine if Vezatin dysfunction contributes to pathology in these conditions

    • Explore whether enhancing Vezatin function could provide therapeutic benefit

  • Developmental neurobiology applications:

    • Study Vezatin's role in neuronal migration and axon pathfinding during development

    • Investigate potential contributions to neurodevelopmental disorders

    • Examine how Vezatin coordinates transport with synapse formation

  • Circuit-specific functions:

    • Determine if Vezatin has different roles in distinct neural circuits

    • Investigate potential contributions to circuit-specific vulnerabilities in disease

    • Develop circuit-targeted approaches to modulate Vezatin function

  • Therapeutic development opportunities:

    • Identify small molecules that can enhance or modify Vezatin function

    • Develop cargo-specific transport enhancers based on Vezatin mechanisms

    • Explore gene therapy approaches to correct Vezatin deficiencies in affected neurons

These research directions leverage the fundamental biological insights from recent discoveries about Vezatin's conserved role in retrograde axonal transport to address significant gaps in our understanding of neurological disease mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.