Recombinant Pongo abelii Vitamin K-dependent gamma-carboxylase (GGCX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this requirement in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GGCX; Vitamin K-dependent gamma-carboxylase; Gamma-glutamyl carboxylase; Peptidyl-glutamate 4-carboxylase; Vitamin K gamma glutamyl carboxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-758
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
AVSARSARTSPGSDKVQKDKAELISGPRQDSLMGKLLGFEWTDLSSWRRLVTLLNRPTDP ASLAVFRFLFGFLMVLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTI MFLGALGMMLGLCYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWS VDGLLNARRRNAHVPLWNYAVLRGQIFIVYFIAGVKKLDADWVEGYSMEYLSRHWLFSPF KLLLSEELTSLLVVHWGGLLLDLSAGFLLFFDASRSIGLFFVSYFHCMNSQLFSIGMFSY VMLASSPLFCSPEWPRKLVSYCPQRLQELLPLKAAPQPSVSCVYKRSRGKSGQKPGLRHQ LGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTG ELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRI FDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLE NFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMY VYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLR RQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVT YANLRPFEQVGELSPSNMDSSHSNPPESNPDPVHSEF
Uniprot No.

Target Background

Function
Mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues. This process occurs concurrently with the conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide.
Database Links
Protein Families
Vitamin K-dependent gamma-carboxylase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of GGCX and what physiological roles does it serve?

GGCX is a dual-functional enzyme that simultaneously oxidizes vitamin K and carboxylates vitamin K-dependent proteins (VKDPs). This post-translational modification converts specific glutamate residues in proteins to gamma-carboxy glutamic acid (Gla) in the presence of reduced vitamin K, molecular oxygen, and carbon dioxide . During this process, reduced vitamin K is converted to vitamin K epoxide, which is subsequently reduced back to vitamin K by vitamin K epoxide reductase (VKOR) for reuse in the carboxylation reaction .

The physiological implications of gamma-carboxylation are diverse and include:

  • Blood coagulation (hemostasis)

  • Bone calcification

  • Signal transduction

The carboxylated proteins' ability to chelate calcium ions is essential for these biological functions. Deficiency of vitamin K can lead to serious conditions such as vitamin K-dependent clotting factor deficiency (VKCFD), osteoporosis, and arterial calcification .

How is GGCX structurally organized and what are its key functional domains?

GGCX consists of several key structural domains that contribute to its function:

  • Transmembrane Domain (TMD): Forms the core structure of the enzyme

  • Propeptide-Binding Domain (PBD): Interacts with the propeptide of VKDPs

  • Luminal Domain: Contains the catalytic center

  • Arch Structure: Exhibits flexibility that affects vitamin K binding

Recent cryo-EM analysis has revealed that the PBD and Arch structures interact with the TMD, though the Arch demonstrates intrinsic flexibility. Molecular dynamics (MD) simulations showed that in the absence of substrate, the Arch helices collapse inward, affecting vitamin K binding stability .

What are the primary substrates of GGCX and how is substrate recognition achieved?

GGCX recognizes its protein substrates through a high-affinity gamma-carboxylation recognition sequence (gamma-CRS) and carries out multiple modifications before releasing the product . This mechanism ensures complete carboxylation of the Gla domain of coagulation factors, which is essential for their biological activity.

Common substrates include:

  • Coagulation factors (e.g., Factor IX)

  • Bone-associated proteins

  • Various other vitamin K-dependent proteins

The enzyme interacts with substrates through both the propeptide binding domain and the catalytic center, where vitamin K and glutamate residues are positioned for the coupled reaction .

What expression systems are optimal for producing recombinant GGCX?

For recombinant GGCX expression, researchers have successfully employed:

  • HEK293 cell systems: Particularly useful for functional studies, as demonstrated in GGCX-deficient HEK293 cells used for the bimolecular fluorescence complementation (BiFC) assay and minigene splicing assays .

  • Expression conditions: Recent research indicates that recombinant GGCX proteins can be diluted in sodium acetate solution (pH a5.5) with 0.01% GDN to a final concentration of 10 ng/μL for experimental procedures .

When designing expression systems for Pongo abelii GGCX specifically, researchers should consider the phylogenetic relationship between human and orangutan proteins, as codon usage patterns show similarities between Homo sapiens and Pongo abelii for certain genes .

What techniques are effective for studying GGCX-substrate interactions?

Several advanced techniques have proven valuable for investigating GGCX-substrate interactions:

  • Bimolecular Fluorescence Complementation (BiFC) Assay:

    • Based on reconstitution of intact Venus fluorescent protein

    • Uses complementary fragments (VN residues 1-173 and VC residues 156-238)

    • Fragments are fused to GGCX and VKD protein substrates

    • Addition of 5 μM warfarin helps stabilize the GGCX-substrate complex

    • Fluorescence measured at Ex 515nm/Em 530nm

  • Cryo-Electron Microscopy (Cryo-EM):

    • Has successfully resolved GGCX structures at resolutions of 2.58-2.78 Å

    • Reveals detailed structural features of GGCX-substrate complexes

    • Identifies key interactions in the catalytic center

  • Molecular Dynamics (MD) Simulations:

    • Conventional and accelerated MD simulations

    • Reveals conformational changes in GGCX domains

    • Quantifies structural dynamics through RMSF and RMSD calculations

How can researchers assess the carboxylation activity of recombinant GGCX?

Researchers can employ cell-based functional assays to evaluate GGCX activity using structurally distinct VKD reporter proteins. A recommended approach includes:

  • Selection of appropriate reporter proteins:

    • Chimeric coagulation factor (FIXgla-PC)

    • Bone Gla protein (BGP)

    • Matrix Gla protein (MGP)

  • Vitamin K-dependent activity assay:

    • Transfect GGCX-deficient cells with wild-type or mutant GGCX

    • Incubate with increasing concentrations of vitamin K

    • Measure carboxylation of reporter proteins

  • Quantification considerations:

    • Account for the stoichiometry between glutamate carboxylation and vitamin K epoxidation (1:1)

    • Consider the number of glutamate residues in different substrates (BGP: 3, MGP: 5, FIXgla-PC: 12)

How does the catalytic reaction center of GGCX function at the molecular level?

The catalytic reaction center of GGCX facilitates the dual function of vitamin K binding and glutamate carboxylation through a sophisticated molecular architecture:

  • Spatial organization:

    • GLA domain binds within an internal cavity formed by the luminal domain and TMD

    • Vitamin K and GLA binding pockets are interconnected, forming the catalytic reaction center

    • A distinct elongated pocket in the TMD accommodates vitamin K (likely as menaquinone-4, MK-4)

  • Vitamin K binding:

    • Cryo-EM analysis of GGCX-K217A/K218A mutant with FIX and FX revealed high-resolution maps of vitamin K

    • The vitamin K hydroquinone form (MKH₂-4) was identified in the binding pocket

    • His160 participates in forming the pocket for vitamin K menaquinone

  • Coupling mechanism:

    • His160 plays a dual role: forming the vitamin K binding pocket and hydrogen bonding with the γ-carboxyl group of glutamate residues

    • This arrangement mediates the coupling between vitamin K epoxidation and glutamate carboxylation

    • The two half-reactions occur in a 1:1 stoichiometry

What is known about the structural dynamics of GGCX and how do they affect function?

GGCX exhibits significant structural dynamics that influence its function:

How do mutations in GGCX affect its biological function and substrate specificity?

Mutations in GGCX can differentially affect its carboxylation activity toward different vitamin K-dependent proteins:

  • Structural basis of mutation effects:

    • Mutations in key residues like Lys217 and Lys218 abolish enzymatic activity

    • Lys217 mediates conformational movement of vitamin K binding to PBD via the Cap-H2 transduction mechanism

    • His160 mutations affect both vitamin K binding and glutamate carboxylation

  • Differential effects on substrates:

    • GGCX mutations can differentially affect the carboxylation of different vitamin K-dependent proteins

    • This differential effect is associated with distinct clinical phenotypes

  • Pre-mRNA splicing effects:

    • Some GGCX missense mutations affect pre-mRNA splicing rather than altering the corresponding amino acid residues

    • This can be assessed using minigene splicing assays based on exon trapping vectors

How conserved is GGCX across species and what evolutionary insights have been gained?

GGCX and the gamma-carboxylation process show remarkable evolutionary conservation:

  • Phylogenetic distribution:

    • Gamma-carboxylation, originally discovered in mammals, is widely distributed throughout the animal kingdom

    • The process has been characterized in diverse species including sea squirt (Ciona intestinalis), flies (Drosophila melanogaster), and marine snails (Conus textile)

  • Evolutionary significance:

    • The presence of gamma-carboxylation in organisms lacking mammalian-like blood coagulation systems suggests broader biological functions

    • Cone snails express a large array of gamma-carboxylated peptides that modulate ion channel activity

  • Evolutionary timing:

    • Evidence suggests gamma-carboxylation is an extracellular post-translational modification that predates the divergence of molluscs, arthropods, and chordates

    • This places the origin of this mechanism deep in metazoan evolution

  • Comparison with primates:

    • While specific data on Pongo abelii GGCX is limited in the search results, comparative analysis of other genes suggests close resemblance between human and orangutan sequences

    • Phylogenetic analysis and relative synonymous codon usage (RSCU) values for other genes show similarities between Homo sapiens and Pongo abelii

What can codon usage patterns tell us about GGCX expression in different species?

Codon usage patterns can provide important insights into gene expression and evolution:

  • Selection versus mutation pressure:

    • Neutrality plot analysis for genes indicates dominance of selection pressure over mutational bias in determining codon usage

    • Parity analysis can reveal preferences for specific nucleotides at the third codon position due to selection pressure

  • Expression efficiency indicators:

    • Codon Adaptation Index (CAI) values close to 1 indicate better adaptation and potentially higher expression

    • P2 analysis can indicate expression levels and the dominance of translational selection

  • tRNA abundance and codon preference:

    • Abundance of tRNA influences gene expression

    • Interestingly, indicated codon preferences do not always correspond to the most abundant tRNA pool, suggesting complex regulatory mechanisms

  • Phylogenetic implications:

    • Codon utilization trends can align with species phylogeny

    • For some genes, Homo sapiens patterns closely resemble those of Pongo abelii, reflecting their evolutionary relationship

What are common technical challenges in GGCX research and how can they be addressed?

Researchers face several technical challenges when working with GGCX:

  • Structural stability:

    • Obtaining apo-GGCX structures has proven difficult, suggesting that substrate binding enhances stability

    • The binding of propeptide enhances the stability of the GGCX luminal domain

    • Addition of stabilizing agents like 0.01% GDN during purification may help maintain protein integrity

  • Activity measurement:

    • Ensure proper experimental design to account for the 1:1 stoichiometry between carboxylation and epoxidation

    • Consider using reporter systems with varied numbers of glutamate residues (3-12) for comprehensive assessment

  • Mutation analysis:

    • Consider both protein-level and mRNA-level effects of mutations

    • Use minigene splicing assays to detect effects on pre-mRNA processing

What future research directions might advance our understanding of GGCX?

Several promising research directions could expand our understanding of GGCX biology:

  • Mechanistic investigations:

    • Determining whether glutamate residue carboxylation is distributive or processive

    • Understanding the auto-carboxylation ability of GGCX

    • Elucidating how oxidized vitamin K epoxide (VKO) is released from GGCX

  • Evolutionary perspectives:

    • Comparative studies of GGCX across diverse species to understand functional conservation and divergence

    • Investigation of species-specific adaptations in GGCX structure and function

  • Therapeutic applications:

    • Better understanding of GGCX could improve anticoagulant therapy

    • Insights into GGCX function may illuminate broader aspects of cellular regulation related to vitamin K metabolism

  • Advanced structural studies:

    • Integration of cryo-EM with molecular dynamics simulations to capture transient states

    • Investigation of GGCX interactions with various substrates and regulators

Stoichiometric relationships in GGCX-catalyzed reactions

VKD ProteinNumber of Glu ResiduesVitamin K Molecules RequiredStoichiometry
Bone Gla Protein (BGP)331:1 per Glu residue
Matrix Gla Protein (MGP)551:1 per Glu residue
FIXgla-PC12121:1 per Glu residue

Experimental parameters for GGCX activity assays

Assay TypeKey ParametersDetection MethodApplications
BiFCEx 515nm/Em 530nm; 5 μM warfarinFluorescence microplate readerProtein-protein interactions
Cell-based functional assayVitamin K titrationReporter protein carboxylationMutational analysis
Minigene splicing assayPCR amplification of affected exonsGel electrophoresis; DNA sequencingPre-mRNA splicing effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.