Recombinant Pongo abelii Voltage-dependent calcium channel gamma-3 subunit (CACNG3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CACNG3; Voltage-dependent calcium channel gamma-3 subunit; Neuronal voltage-gated calcium channel gamma-3 subunit; Transmembrane AMPAR regulatory protein gamma-3; TARP gamma-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV
Uniprot No.

Target Background

Function
This protein regulates the trafficking to the somatodendritic compartment and gating properties of AMPA-selective glutamate receptors (AMPARs). It promotes their targeting to the cell membrane and synapses, and modulates their gating properties by slowing their rates of activation, deactivation, and desensitization. This protein does not exhibit subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. It is believed to stabilize the calcium channel in an inactivated (closed) state.
Database Links
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does CACNG3 contribute to calcium channel function?

CACNG3 functions as a regulatory subunit of L-type calcium channels, which are composed of five subunits in total. As an integral membrane protein, CACNG3 is thought to stabilize the calcium channel in an inactive (closed) state. This regulatory function is critical for proper neuronal excitability and signaling.

Beyond calcium channel regulation, CACNG3 also regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It promotes their targeting to the cell membrane and synapses while modulating their gating properties by slowing their rates of activation, deactivation, and desensitization. Unlike some other regulatory proteins, CACNG3 does not show subunit-specific AMPA receptor regulation but rather affects all AMPAR subunits .

What is the evolutionary conservation of CACNG3 between humans and Pongo abelii?

CACNG3 shows significant evolutionary conservation between humans and Pongo abelii (Sumatran orangutan), reflecting its essential neurological functions. Comparative analysis reveals high sequence homology, with the UniProt entry Q5R5X2 representing the Pongo abelii variant. This conservation suggests that functional studies using the orangutan variant may provide valuable insights applicable to human CACNG3 function.

The high degree of conservation is particularly pronounced in the transmembrane domains and in regions that interact with calcium channels and AMPA receptors. This conservation underscores the functional importance of these domains across primate species .

What is the tissue-specific expression pattern of CACNG3?

CACNG3 is expressed exclusively in the brain, with particularly high expression in specific neuronal populations. Within the brain, CACNG3 is predominantly localized to the postsynaptic densities of dendritic structures in hippocampal mossy fiber synapses. This specific localization pattern suggests a critical role in synaptic transmission and plasticity in these regions.

Expression studies have demonstrated that CACNG3 has a distinct distribution pattern compared to other calcium channel gamma subunits, suggesting specialized functions in different neuronal circuits .

How can researchers efficiently detect CACNG3 expression in experimental systems?

Detecting CACNG3 expression in experimental systems can be achieved through multiple complementary approaches:

  • RT-PCR and qPCR: For quantitative assessment of mRNA expression levels, with specific primers designed to target conserved regions of CACNG3.

  • Western blotting: Using antibodies specific to CACNG3 for protein detection. When working with recombinant Pongo abelii CACNG3, researchers should consider using antibodies that recognize conserved epitopes.

  • Immunohistochemistry (IHC): For spatial localization in tissue sections, as demonstrated in glioma studies where CACNG3 expression was correlated with tumor grade and patient outcomes .

  • RNA-seq: For comprehensive transcriptomic analysis, particularly useful for examining CACNG3 expression in the context of broader gene expression patterns.

When designing detection experiments, researchers should account for potential cross-reactivity with other calcium channel gamma subunits due to sequence similarities .

What are the optimal conditions for handling recombinant Pongo abelii CACNG3 protein?

Recombinant Pongo abelii CACNG3 protein requires specific handling conditions to maintain stability and functionality:

ParameterRecommended Condition
Storage Temperature-20°C for regular use; -80°C for long-term storage
Buffer CompositionTris-based buffer with 50% glycerol
Freeze-Thaw CyclesMinimize; repeated freezing and thawing not recommended
Working StorageAliquot and store at 4°C for up to one week
Quantity per ExperimentTypically 50 μg, though adjustable based on experimental needs

These conditions are optimized to preserve the structural integrity and functional properties of the recombinant protein for experimental applications. For experiments requiring native conformation, researchers should avoid conditions that might denature the protein's transmembrane domains .

How can CACNG3 be effectively used in ELISA-based experimental designs?

For ELISA-based detection and quantification of CACNG3, researchers should consider the following methodological approach:

  • Antibody Selection: Use antibodies targeting conserved epitopes of CACNG3 that do not cross-react with other calcium channel gamma subunits.

  • Assay Optimization:

    • Coating concentration: 1-10 μg/ml of capture antibody

    • Blocking buffer: 1-5% BSA or serum from a different species than the antibody source

    • Sample dilution: Optimize based on expected CACNG3 concentration

    • Detection system: HRP-conjugated secondary antibodies with appropriate substrate

  • Quantification: Generate a standard curve using purified recombinant Pongo abelii CACNG3 protein at known concentrations (typically 0.1-1000 ng/ml).

  • Controls: Include positive controls (samples with known CACNG3 expression) and negative controls (samples from tissues not expressing CACNG3) to validate assay specificity .

What are effective experimental strategies to study CACNG3 function in neuronal systems?

To study CACNG3 function in neuronal systems, researchers can employ several complementary approaches:

  • Overexpression and Knockdown Studies:

    • Transfect neurons with CACNG3 expression vectors or siRNA

    • Assess effects on calcium channel properties, AMPAR trafficking, and synaptic function

    • Use electrophysiological recordings to measure changes in channel kinetics

  • Mutation Analysis:

    • Introduce specific mutations in functional domains

    • Evaluate effects on protein-protein interactions and channel function

    • Compare with naturally occurring variants associated with neurological disorders

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify binding partners

    • FRET or BRET assays to study dynamic interactions with channel subunits and AMPARs

    • Yeast two-hybrid screening for novel interactors

  • Live Cell Imaging:

    • Tag CACNG3 with fluorescent proteins to track localization and trafficking

    • Use photoactivatable tags to study protein dynamics at synapses

    • Combine with electrophysiology for structure-function analysis .

How is CACNG3 implicated in epilepsy and seizure disorders?

CACNG3 has been identified as a potential susceptibility gene for childhood absence epilepsy (CAE), a form of idiopathic generalized epilepsy characterized by absence seizures with 2.5-4 Hz spike-wave complexes on ictal EEG. Significant evidence from linkage studies supports CACNG3 as a susceptibility locus in a subset of CAE patients.

A comprehensive linkage analysis study using 65 nuclear families with CAE probands yielded a significant HLOD score of 3.54 (α=0.62) for markers encompassing CACNG3. The maximum non-parametric linkage score was 2.87 (P<0.002). Transmission disequilibrium was found for SNPs within a ~35 kb region of high linkage disequilibrium encompassing the 5'UTR, exon 1, and part of intron 1 of CACNG3.

Interestingly, CACNG3 shows similarity to the mouse stargazin protein (encoded by CACNG2), mutations in which are associated with absence seizures in the stargazer mouse model. This functional similarity supports the potential role of CACNG3 in human epilepsy .

What is the evidence for CACNG3 as a prognostic biomarker in gliomas?

Recent research has identified CACNG3 as a potential prognostic biomarker in gliomas, the most common malignant primary brain tumors in adults. Key findings include:

These observations suggest that CACNG3 may serve as a valuable prognostic indicator in glioma patients and potentially offer insights into novel therapeutic approaches. The mechanism by which CACNG3 influences glioma progression remains under investigation, but may involve its role in calcium signaling and/or AMPAR regulation .

What are the current challenges in studying CACNG3 function across species?

Researchers face several challenges when studying CACNG3 function across species, particularly when using recombinant Pongo abelii CACNG3 as a model for human CACNG3:

  • Subtle Sequence Differences: Despite high conservation, subtle amino acid differences between species may affect protein interactions and regulatory functions.

  • Context-Dependent Activity: CACNG3 function may depend on the specific cellular context and the expression of other interacting proteins, which may vary between species.

  • Technical Limitations:

    • Lack of species-specific antibodies for detection

    • Challenges in maintaining native conformation in recombinant proteins

    • Limited availability of appropriate cellular models for functional studies

  • Data Integration Challenges: Reconciling findings from different model systems and relating them to human physiology requires sophisticated comparative analyses.

To address these challenges, researchers should employ multiple complementary approaches, including cross-species computational analyses, careful validation across model systems, and where possible, studies in human-derived systems .

How can contradictory findings in CACNG3 research be reconciled?

Contradictory findings in CACNG3 research may arise from various sources and can be addressed through systematic approaches:

  • Experimental System Variations:

    • Different cell types or brain regions studied

    • Variations in expression levels of CACNG3 and interacting proteins

    • Species differences in CACNG3 function

  • Methodological Considerations:

    • Differences in protein preparation and handling

    • Variability in assay sensitivity and specificity

    • Different analytical approaches for data interpretation

  • Reconciliation Strategies:

    • Meta-analysis of published studies with attention to methodological differences

    • Replication studies with standardized protocols

    • Direct comparison of different experimental systems within the same study

    • Integration of findings through systems biology approaches

  • Data Sharing and Collaboration:

    • Establish consortia for CACNG3 research

    • Develop standardized protocols and reporting guidelines

    • Create accessible databases of experimental results .

What cutting-edge methodologies are advancing CACNG3 functional studies?

Several cutting-edge methodologies are transforming our understanding of CACNG3 function:

  • CRISPR-Cas9 Genome Editing:

    • Precise modification of CACNG3 in various model systems

    • Creation of knock-in models with specific mutations or tags

    • Generation of conditional knockout systems for tissue-specific studies

  • Single-Cell Analysis:

    • Single-cell RNA-seq to examine cell-type-specific expression patterns

    • Patch-seq combining electrophysiology with transcriptomics

    • Single-molecule imaging to track CACNG3 dynamics in living cells

  • Advanced Structural Biology:

    • Cryo-EM studies of CACNG3 in complex with calcium channels or AMPARs

    • Molecular dynamics simulations to predict protein interactions

    • Structure-based drug design targeting CACNG3 or its interactions

  • Integrative Multi-omics Approaches:

    • Combining proteomics, transcriptomics, and functional data

    • Network analysis to place CACNG3 in broader signaling pathways

    • Machine learning for predictive modeling of CACNG3 functions

  • Translational Applications:

    • Patient-derived organoids for studying CACNG3 in disease contexts

    • High-throughput screening for modulators of CACNG3 function

    • Development of biomarkers based on CACNG3 expression or activity .

What are the most promising future research directions for CACNG3 studies?

The study of CACNG3, particularly the recombinant Pongo abelii variant, offers several promising research directions:

  • Comparative Neurobiology: Exploring the evolutionary conservation and divergence of CACNG3 function across primate species to understand fundamental aspects of neuronal calcium signaling.

  • Precision Medicine Applications: Developing CACNG3-based biomarkers for neurological disorders and brain tumors, with potential applications in diagnostic and prognostic tools.

  • Therapeutic Target Development: Investigating CACNG3 as a potential therapeutic target for conditions like epilepsy and gliomas, based on its role in calcium channel regulation and disease associations.

  • Systems Neuroscience: Integrating CACNG3 studies into broader investigations of neuronal network function and synaptic plasticity, particularly in learning and memory.

  • Technological Innovations: Developing new tools and methodologies specifically designed for studying membrane proteins like CACNG3, including improved recombinant protein production systems and functional assays.

These directions highlight the multifaceted significance of CACNG3 in neurobiology and disease, emphasizing the need for continued research using both basic and advanced approaches .

How might understanding CACNG3 contribute to therapeutic developments?

Understanding CACNG3 function has significant potential for therapeutic developments in several neurological conditions:

  • Epilepsy Treatment: Given the association of CACNG3 with childhood absence epilepsy, targeting its function or expression might offer novel approaches for seizure control. Modulating its interaction with calcium channels or AMPARs could provide more specific treatments with fewer side effects than current antiepileptic drugs.

  • Glioma Therapy: The identification of CACNG3 as a prognostic biomarker in gliomas suggests potential therapeutic relevance. Strategies to restore or enhance CACNG3 expression in tumors might improve outcomes, particularly if its low expression contributes to tumor progression or treatment resistance.

  • Neuropsychiatric Applications: The role of CACNG3 in glutamatergic signaling through AMPAR regulation suggests potential applications in conditions like depression, where glutamate dysregulation is implicated.

  • Precision Medicine Approaches: Genetic variations in CACNG3 could inform personalized treatment strategies, particularly in epilepsy patients, allowing for tailored therapeutic approaches based on individual genetic profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.