Recombinant Pongo abelii Zinc transporter 3 (SLC30A3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of that tag type.
Synonyms
SLC30A3; ZNT3; Zinc transporter 3; ZnT-3; Solute carrier family 30 member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SLC30A3
Target Protein Sequence
MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPL PPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSL FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAM LLTASIAVCANLLMAFVLHQAGPPHSHGSKGAEYAPLEEGPEEPLPLGNTSVRAAFVHVL GDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNV GFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRF GFSSCTLQVEQYQPEMAQCLRCQEPPQA
Uniprot No.

Target Background

Function
This protein plays a role in zinc accumulation within synaptic vesicles.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome. Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.

Q&A

What is SLC30A3/ZnT3 and what is its primary function in neuronal systems?

SLC30A3, also known as Zinc Transporter 3 (ZnT3), is a member of the zinc transporter family that plays a critical role in the accumulation of zinc ions inside synaptic vesicles of neurons. The protein contains six transmembrane domains that enclose a pore lined with a histidine-rich loop . ZnT3 functions as a putative transporter that facilitates the movement of zinc ions into synaptic vesicles, where they can be subsequently released during synaptic transmission to modulate various neuronal targets .

The expression of ZnT3 is predominantly restricted to tissues of the brain and testis, with specific expression detected in epithelial cells of the choroid plexus, Bergman glial cells of mouse cerebellar cortex, and postganglionic neurons of mouse superior cervical ganglia . Research also indicates that SLC30A3 expression is age-dependent, particularly in the cerebral cortex and pancreatic islets .

How does Pongo abelii ZnT3 compare to human and other mammalian ZnT3 proteins?

Comparative sequence analysis reveals significant homology between Pongo abelii ZnT3 and other mammalian ZnT3 proteins. The human ZnT3 protein also consists of 388 amino acids and shares considerable sequence similarity with the Pongo abelii version . Within the broader mammalian context, the human ZnT3 protein demonstrates 86% and 87% sequence homology with rat and mouse ZnT3 proteins, respectively .

This high degree of conservation across species suggests evolutionary importance of the ZnT3 structure and function. Additionally, ZnT3 shares approximately 44% homology with ZnT8, another member of the same transporter family that plays an essential role in insulin crystallization within pancreatic beta-cells . This structural relationship provides insights into potential functional similarities and differences among zinc transporters in various physiological contexts.

What are optimal storage and handling conditions for recombinant SLC30A3 proteins?

For optimal maintenance of recombinant Pongo abelii SLC30A3 protein stability and activity, the following storage and handling protocols are recommended:

Storage ConditionRecommendation
Short-term storageStore working aliquots at 4°C for up to one week
Long-term storageStore at -20°C/-80°C
Storage bufferTris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionReconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL
AliquotingAdd glycerol (final concentration 5-50%) and prepare small aliquots for long-term storage
AvoidRepeated freeze-thaw cycles

Before opening vials containing the protein, brief centrifugation is recommended to bring the contents to the bottom . These handling practices ensure maximum retention of protein stability and functional activity for experimental applications.

What methodological approaches can be used to study ZnT3 function in vesicular zinc transport?

Investigating ZnT3 function in vesicular zinc transport requires sophisticated methodological approaches:

  • Genetic Knockout Models: ZnT3 knockout mice have been extensively used to study the role of vesicular zinc in neuronal function . These models allow researchers to examine the consequences of vesicular zinc elimination on various neurobiological processes. When designing knockout experiments, researchers should consider:

    • Age- and sex-specific variations in phenotypic expression

    • Control for compensatory mechanisms that may activate in the absence of ZnT3

    • Use of appropriate wild-type controls matched for age, sex, and genetic background

  • Fluorescent Zinc Imaging: Fluorescent probes specific for zinc can be used to visualize and quantify zinc accumulation in synaptic vesicles. This approach can be combined with recombinant ZnT3 expression systems to assess transport activity.

  • Electrophysiological Recordings: To examine the functional consequences of ZnT3-mediated zinc transport on synaptic transmission, researchers can employ patch-clamp recording techniques in neuronal cultures expressing recombinant ZnT3.

How should researchers address sex-specific differences in ZnT3-related studies?

Recent findings have revealed important sex-specific differences in ZnT3-related biological processes that researchers must consider when designing experiments . Specifically:

  • BDNF Expression Patterns: Research has demonstrated that BDNF protein levels increase with age in female mice but not in males . Additionally, female ZnT3 knockout mice exhibit greater hippocampal BDNF mRNA expression compared to wild-type females, a difference not observed in males .

  • Experimental Design Recommendations:

    • Include both male and female subjects in study designs

    • Analyze data stratified by sex rather than pooling

    • Control for hormonal status in female subjects, which may influence ZnT3 and zinc-related signaling pathways

    • Consider age as an important variable that may interact with sex in determining ZnT3 function and related outcomes

  • Statistical Approach: Implement two-way ANOVA analyses that incorporate sex as a biological variable, allowing for the detection of sex-specific effects and sex-by-treatment interactions.

This attention to sex differences is particularly important for translational research, as findings in one sex may not generalize to the other.

What are effective approaches for investigating SLC30A3 polymorphisms in relation to neuropsychiatric disorders?

Investigating SLC30A3 polymorphisms and their association with neuropsychiatric disorders requires rigorous methodological approaches:

  • SNP Selection and Genotyping:

    • Target specific SNPs with functional relevance, such as rs11126936, which has been associated with major depressive disorder and schizophrenia

    • Employ robust genotyping methods, such as PCR-restriction fragment length polymorphism (PCR-RFLP) analysis

    • Validate results by sequencing a subset (e.g., 10%) of samples

  • Study Design Considerations:

    • Implement case-control matching (1:1) by age, gender, and ethnicity to minimize confounding

    • Control for relevant socioeconomic variables such as occupation and income

    • Ensure adequate sample size for detecting genetic associations (e.g., 300 cases and 300 controls)

  • Statistical Analysis:

    • Test for deviation from Hardy-Weinberg equilibrium using chi-square tests

    • Apply conditional logistic regression to estimate adjusted odds ratios

    • Calculate confidence intervals (typically 95%) to establish the precision of estimated effects

Research examining the rs11126936 SNP has shown that genotypes G/G and G/T are associated with approximately two times greater odds of developing major depressive disorder compared to the T/T variant (OR=1.983, 95% CI=1.031-3.815, p=0.040 and OR=2.232, 95% CI=1.100-4.533, p=0.026, respectively) .

What considerations are important when interpreting contradictory findings in ZnT3 research?

Researchers often encounter contradictory findings when studying ZnT3 function, particularly regarding its effects on downstream signaling molecules like BDNF and TrkB. When interpreting such contradictions, consider:

  • Age-Dependent Effects: ZnT3 expression exhibits age-dependent patterns in various tissues . Studies conducted in animals of different ages may yield divergent results, necessitating careful age matching and age-stratified analyses.

  • Sex as a Biological Variable: As previously discussed, sex-specific differences in ZnT3-related processes have been documented . Contradictory findings may reflect genuine biological differences between males and females rather than experimental inconsistencies.

  • Environmental Conditions: Research indicates that the phenotypic consequences of ZnT3 deletion may manifest differently depending on housing and experimental conditions . Standard laboratory conditions may not elicit the same effects as more challenging or enriched environments.

  • Methodological Variations: Different protein quantification methods, brain region specificity, and statistical approaches may contribute to apparently contradictory findings. Detailed reporting of methodological procedures is essential for meaningful cross-study comparisons.

  • Genetic Background: The genetic background of animal models can significantly influence the phenotypic expression of ZnT3 manipulations, potentially accounting for inconsistent findings across studies using different strains.

What are current technical challenges in producing and working with recombinant Pongo abelii SLC30A3?

Researchers working with recombinant Pongo abelii SLC30A3 face several technical challenges:

  • Expression System Selection: While E. coli is commonly used for expression of recombinant SLC30A3 , this prokaryotic system may not replicate all post-translational modifications present in mammalian cells. Researchers should consider:

    • Using mammalian expression systems for studies requiring native protein conformation

    • Assessing the impact of expression system on protein functionality

    • Validating findings with native protein where possible

  • Protein Solubility and Stability: As a membrane protein with six transmembrane domains , SLC30A3 presents challenges related to solubility and stability. Researchers may need to:

    • Optimize buffer conditions (pH, ionic strength, detergents)

    • Incorporate stabilizing agents such as glycerol or trehalose

    • Consider fusion partners that enhance solubility

  • Functional Assays: Developing reliable assays to assess the zinc transport activity of recombinant SLC30A3 requires:

    • Reconstitution into lipid bilayers or liposomes to recreate the native membrane environment

    • Use of zinc-specific fluorescent probes with appropriate sensitivity

    • Controls for non-specific zinc binding and transport

  • Antibody Specificity: Ensuring the specificity of antibodies used for detection and purification of recombinant SLC30A3 is critical, particularly given the sequence homology with other SLC30 family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.