Recombinant Pongo abelii Zinc transporter 9 (SLC30A9)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo abelii Zinc Transporter 9 (SLC30A9)

Recombinant Pongo abelii Zinc transporter 9 (SLC30A9) refers to a genetically engineered version of the zinc transporter protein found in the Sumatran orangutan (Pongo abelii). This protein is part of the SLC30A family, which plays a crucial role in maintaining zinc homeostasis within cells. Zinc transporters are essential for various cellular functions, including enzyme activity, protein synthesis, and cell signaling. While specific research on the recombinant version of this protein in Pongo abelii is limited, understanding its function and significance can be inferred from studies on similar zinc transporters in other species.

Function and Significance of Zinc Transporters

Zinc transporters like SLC30A9 are vital for regulating zinc levels within cells. They ensure that zinc is properly distributed and utilized by various cellular components, such as mitochondria, where it is crucial for energy production and other metabolic processes. In humans and other mammals, mutations in zinc transporters have been linked to various diseases, highlighting their importance in maintaining cellular health .

Research Findings on SLC30A9

SLC30A9, specifically, is a mitochondria-resident zinc transporter. Research in humans and model organisms has shown that mutations in this gene can lead to severe developmental and neurological disorders . In Drosophila melanogaster, knockdown of the ZnT9 orthologue results in impaired movement and mitochondrial deformation, underscoring the critical role of this transporter in zinc homeostasis .

Table: Comparison of SLC30A9 Functions Across Species

SpeciesFunction of SLC30A9Effects of Mutation/Knockdown
HumanMitochondrial zinc regulationCerebro-renal syndrome, developmental abnormalities
MouseMitochondrial zinc regulationMidgestational lethality, dwarfism
DrosophilaMitochondrial zinc regulationImpaired movement, mitochondrial deformation

Potential Applications of Recombinant Zinc Transporters

Recombinant zinc transporters, including those from Pongo abelii, could potentially be used in biotechnology applications to enhance zinc uptake in organisms grown in environments with limited zinc availability. This could improve crop yields or enhance the nutritional content of food products. Additionally, understanding the mechanisms of zinc transporters could lead to new therapeutic strategies for diseases related to zinc dyshomeostasis .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include this information in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Please note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC30A9; Zinc transporter 9; ZnT-9; Solute carrier family 30 member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-569
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MLPGLAAAAAAHRCSWSSLCRLRPRCRAAACNPSDCQEWQNLVTFGSFSNMVPCSHPYIG TLSQVKLYSTDVQKEGQGSQTLRVEKVPSFETAEGIGAELKAPLKQEPLQVRVKAVLKKR EYGSKYTQNNFITGVRAINEFCLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLE VWGSPEALAREKKLRKEAEIEYRERLFRNQKILREYRDFLGNTKPRSRTASVFFKGPGKV VMVAICINGLNCFFKFLAWIYTGSASMFSEAIHSLSDTCNQGLLALGISKSVQTPDPSHP YGFSNMRYISSLISGVGIFMMGAGLSWYHGVMGLLHPQPIESLLWAYCILAGSLVSEGAT LLVAVNELRRNARAKGMSFYKYVMESRDPSTNVILLEDTAAVLGVIIAATCMGLTSITGN PLYDSLGSLGVGTLLGMVSAFLIYTNTEALLGRSIQPEQVQRLTELLENDPSVRAIHDVK ATDLGLGKVRFKAEVDFDGRVVTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENII DTLGAEVDRLEKELKKRNPEVRHVDLEIL
Uniprot No.

Target Background

Function
Zinc transporter 9 (SLC30A9) functions as a zinc transporter involved in intracellular zinc homeostasis. It acts as a secondary coactivator for nuclear receptors, collaborating with p160 coactivator subtypes. SLC30A9 plays a role in transcriptional activation of Wnt-responsive genes.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Nucleus. Cytoplasm. Cytoplasmic vesicle. Endoplasmic reticulum.

Q&A

What is the difference between SLC30A9 and SLC39A9 (ZIP9)?

SLC30A9 and SLC39A9 (ZIP9) belong to different families of zinc transporters with distinct functions. SLC30A9 is part of the SLC30 family (also known as ZnT transporters) that primarily function to export zinc from cellular compartments. Specifically, SLC30A9 exports zinc from mitochondria, as evidenced by studies showing that SLC30A9 knockout results in zinc accumulation in mitochondria . In contrast, SLC39A9 (ZIP9) belongs to the SLC39 family that generally imports zinc into cells or cellular compartments. These functional differences are critical when designing experiments investigating zinc homeostasis in cellular systems.

How does SLC30A9 deficiency affect mitochondrial function?

SLC30A9 deficiency leads to multiple mitochondrial defects. Research using SLC30A9 knockout HeLa cells revealed:

  • Reduced oxygen consumption rates (OCRs), including both ATP-linked OCR and maximal respiration capacity, indicating compromised metabolic activity .

  • Lower steady-state NADH/NAD⁺ ratio compared to control cells, consistent with reduced oxidative phosphorylation .

  • Decreased abundance of specific respiratory chain components, particularly complex I subunit NDUFB8 and complex III subunit UQCRC2, while complex V-ATP5A levels remained normal .

  • Direct measurement of complex I activity showed reduced function in SLC30A9⁻/⁻ cells .

  • Abnormally reductive conditions in mitochondria, evidenced by an increased GSH/GSSG ratio, suggesting defective oxidative processes .

What mechanisms underlie zinc transport by SLC30A9?

SLC30A9 likely functions as a Zn²⁺/H⁺ exchanger, sharing extensive sequence homology with the bacterial Zn²⁺/H⁺ exchanger YiiP . Structure-function studies support this hypothesis:

  • Sequence homology analysis and comparison with known protein structures of YiiP, ZnT2, and ZnT8 identified putative Zn²⁺/H⁺ binding sites .

  • Site-directed mutagenesis experiments demonstrated that the H198A mutation partially rescued the mitochondrial swelling phenotype in slc-30a9 mutants, while the D323A mutation showed no rescue activity .

  • These results suggest that SLC30A9 utilizes the mitochondrial proton gradient to transport Zn²⁺, functioning as a proton-dependent antiporter .

This mechanism explains how SLC30A9 can export zinc from mitochondria against its concentration gradient by coupling zinc transport to the proton motive force across the mitochondrial membrane.

How does SLC30A9 contribute to reproductive biology?

SLC30A9 plays a critical role in sperm function:

  • In C. elegans, SLC30A9 is required for sperm activation by weak bases like TEA/ammonium chloride, a process involving zinc extrusion from mitochondria .

  • Experimental evidence shows that zinc chelators and mitochondrial membrane potential blockers inhibit sperm activation, supporting the model that SLC30A9 mediates proton gradient-dependent zinc mobilization from mitochondria during this process .

  • SLC30A9 is also required for normal brood size in vivo, suggesting a physiological role in sperm activation and fertility .

  • This function appears to be conserved across species, as zinc mobilization is important for sperm function in multiple organisms, including sea urchins and mammals .

These findings highlight the importance of dynamic zinc regulation via SLC30A9 not just for steady-state homeostasis but also for signal transduction during reproductive processes.

How can CRISPR-Cas9 be used to generate SLC30A9 knockout models?

The search results provide a detailed protocol for SLC30A9 knockout using CRISPR-Cas9:

  • sgRNA Design: Select an optimal sgRNA sequence using a CRISPR design tool. For SLC30A9, the sequence 5′-CCCTGTAGTCATCCATATATTGG-3′ targeting exon 2 was effectively used .

  • Vector Construction: Express the sgRNA in a suitable vector, such as AAV-U6-sgRNA-CMV-mCherry .

  • Cell Line Expression: Introduce the sgRNA expression vector into cells already stably expressing Cas9 protein .

  • Clone Selection: Sort cells expressing the marker (e.g., mCherry) using fluorescence-activated cell sorting (FACS). For the reported study, a BD FACSAria TMIIIu was used .

  • Clone Expansion: Select and expand single clones for biological assays .

  • Verification: Confirm knockout using sequence analysis of the targeted gene region. For SLC30A9, the following primers were used: forward, 5′-AAAATCGGTGACAGT-ATGAATGAAT-3′ and reverse, 5′-TAATAAAACACAAACCTCTGGGAAG-3′ .

This protocol can be adapted for generating knockout models in different cell lines to study the function of SLC30A9 in various cellular contexts.

What techniques can be used to assess mitochondrial function in zinc transporter studies?

Several complementary techniques for evaluating mitochondrial function in the context of zinc transporter research include:

  • Oxygen Consumption Rate (OCR) Measurement:

    • Use a metabolic analyzer to measure OCR

    • Treat cells sequentially with:

      • Oligomycin (to inhibit ATP synthase)

      • FCCP (carbonyl cyanide 4-(trifluoromethoxy) phenylhydrazone, a mitochondrial uncoupler)

      • Rotenone and antimycin A (to inhibit electron transport chain)

    • Calculate ATP-linked OCR and maximal respiration capacity from the resulting data

  • NADH/NAD⁺ Measurement:

    • Utilize Mito-SoNar, a highly sensitive NADH/NAD⁺-specific sensor with subcellular resolution

    • As a positive control, treat cells with pyruvate and observe the change in 420/485-nm ratio

    • Compare steady-state NADH/NAD⁺ ratios between experimental and control groups

  • Respiratory Complex Abundance Assessment:

    • Use OXPHOS antibodies to measure the abundance of mitochondrial respiratory complexes

    • Specifically examine complex I subunit NDUFB8, complex III subunit UQCRC2, and complex V-ATP5A

  • Complex I Activity Measurement:

    • Directly measure the activity of mitochondrial respiratory chain complex I using specialized assays

  • Redox State Evaluation:

    • Express mitochondria-targeted Grx1-roGFP2 to measure the GSH/GSSG ratio

    • Validate the sensor using dithiothreitol (to increase GSH/GSSG ratio) and diamide (to decrease GSH/GSSG ratio)

    • Compare the GSH/GSSG ratio between experimental and control groups

    • Alternatively, extract mitochondria and measure the GSH/GSSG ratio using a dedicated assay kit

These methods provide complementary data on different aspects of mitochondrial function and can reveal how zinc transporters like SLC30A9 impact energy metabolism and mitochondrial physiology.

How should recombinant zinc transporter proteins be handled for optimal activity?

Based on the product information for recombinant Pongo abelii ZIP9 (SLC39A9), the following handling procedures are recommended:

  • Storage Conditions:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution Protocol:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage at -20°C/-80°C

  • Storage Buffer:

    • The protein is supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Quality Control:

    • Verify protein purity (should be greater than 90% as determined by SDS-PAGE)

These guidelines ensure optimal protein stability and activity, which is critical for experimental reliability when working with recombinant zinc transporters in research settings.

What methods can be used to visualize zinc distribution in cells studying zinc transporters?

For studying zinc transporters like SLC30A9 and SLC39A9, several techniques can be employed to visualize zinc distribution:

  • Genetically Encoded Zinc Sensors:

    • Mitochondria-localized, genetically encoded Zn²⁺ sensors can be expressed in cells

    • These sensors can provide real-time, subcellular resolution of zinc levels

    • They allow for the detection of dynamic changes in zinc concentration during cellular processes

  • Zinc-Specific Fluorescent Probes:

    • Chemical probes with specific subcellular targeting capabilities

    • Can be used to visualize zinc redistribution during processes like sperm activation

    • Allow for comparison between wild-type and transporter-deficient cells

  • Ultrastructural Analysis:

    • Electron microscopy can be used to examine structural changes associated with zinc accumulation

    • This approach revealed that SLC30A9 mutant mitochondria become enlarged with disappearing cristae in both worm sperm and HeLa cells

  • Zinc Mobilization Assays:

    • Treatment with weak bases like TEA/ammonium chloride can be used to induce zinc mobilization

    • Combined with zinc sensors, this approach can reveal the dynamics of zinc transport

    • Zinc chelators and mitochondrial membrane potential blockers can be used as controls to confirm the specificity of the observed effects

These methods provide complementary information about zinc distribution and dynamics, which is essential for understanding the function of zinc transporters in different cellular contexts.

What are potential pitfalls in interpreting zinc transporter knockout phenotypes?

When interpreting phenotypes of zinc transporter knockouts like SLC30A9, researchers should consider several potential confounding factors:

  • Compensatory Mechanisms: Other zinc transporters may partially compensate for the loss of the targeted transporter, potentially masking the full phenotype. For example, other members of the SLC30 family might partially compensate for SLC30A9 deficiency, requiring careful examination of multiple zinc transport pathways.

  • Secondary Effects: The primary defect in zinc homeostasis may lead to numerous secondary effects that are not directly caused by the transporter itself. In SLC30A9 knockout cells, mitochondrial swelling and cristae disruption could lead to multiple downstream consequences that are indirect effects of the primary zinc imbalance .

  • Developmental vs. Acute Effects: In model organisms, germline knockouts may have developmental consequences that differ from acute knockdowns in adult tissues. This consideration is particularly important when studying zinc transporters involved in fertility and development .

  • Tissue-Specific Functions: Zinc transporters often have tissue-specific roles. The research shows that SLC30A9 is important in both sperm cells and neurons, with potentially different functional consequences in each tissue type .

  • Species-Specific Differences: While the zinc transport function appears conserved across species, the specific physiological roles may vary. The researchers demonstrated SLC30A9 function in both C. elegans and human cells, indicating conservation but potentially with species-specific nuances .

Careful experimental design with appropriate controls and multiple complementary approaches can help address these potential pitfalls.

How can researchers differentiate between direct and indirect effects of zinc transporter disruption?

To distinguish direct from indirect effects of zinc transporter disruption:

  • Rescue Experiments: Reintroducing the wild-type transporter should reverse direct effects. The research demonstrated that introducing the H198A variant of SLC30A9 partially rescued the mitochondrial swelling phenotype, while the D323A variant showed no rescue activity, suggesting direct mechanistic insights into the protein's function .

  • Zinc Supplementation or Chelation: Manipulating zinc levels can help determine whether phenotypes are directly related to zinc imbalance. The research used zinc chelators to investigate the role of zinc in sperm activation, confirming the direct link between zinc mobilization and cellular function .

  • Temporal Analysis: Monitoring the sequence of events following transporter disruption can help establish cause-effect relationships. Early changes are more likely to be direct effects, while later changes might represent secondary consequences.

  • Structure-Function Studies: Targeted mutations of specific functional domains can link molecular functions to cellular phenotypes. The researchers introduced specific mutations (D323A and H198A) to disrupt putative Zn²⁺/H⁺ binding sites, providing mechanistic insights into how SLC30A9 functions .

  • Combined Genetic Approaches: Creating double knockouts with other zinc homeostasis genes can reveal functional relationships and compensatory mechanisms. This approach can help determine whether observed phenotypes are specifically due to the targeted transporter or represent broader disruptions in zinc homeostasis.

By integrating these approaches, researchers can build a more comprehensive and accurate understanding of zinc transporter function in cellular physiology.

What are promising research avenues for understanding zinc transporter functions in disease models?

Several promising research directions emerge from the current understanding of zinc transporters like SLC30A9:

  • Neurological Disorders: The research suggests that mitochondrial swelling and transport defects in neurons might underlie one form of cerebrorenal syndrome . Further investigation into the role of SLC30A9 in neuronal function and neurodegenerative diseases represents a valuable research direction.

  • Fertility Research: Given the critical role of SLC30A9 in sperm activation and zinc mobilization, further studies on zinc transporter functions in reproductive biology could yield insights into fertility disorders and potential therapeutic approaches .

  • Mitochondrial Diseases: The profound effects of SLC30A9 deficiency on mitochondrial morphology and function suggest that zinc transporters might play underappreciated roles in mitochondrial diseases. Investigating zinc dysregulation in established mitochondrial disease models could reveal new therapeutic targets .

  • Metabolic Disorders: The observed defects in oxidative phosphorylation and cellular metabolism in SLC30A9-deficient cells indicate potential connections to metabolic disorders. Exploring these links in relevant disease models could provide new perspectives on metabolic regulation .

  • Comparative Physiological Studies: Extending the investigation of zinc transporters across different species and tissues could reveal evolutionary conservation and specialization of zinc transport mechanisms, providing broader insights into zinc homeostasis regulation .

These research directions hold promise for both basic science advances and potential therapeutic applications in various disease contexts.

How can structural biology approaches advance our understanding of zinc transporters?

Structural biology approaches offer significant potential for advancing zinc transporter research:

  • Detailed Structural Analysis: Building on the sequence homology with bacterial Zn²⁺/H⁺ exchanger YiiP, more detailed structural studies of SLC30A9 and SLC39A9 could reveal critical insights into transport mechanisms . Techniques such as cryo-electron microscopy or X-ray crystallography could elucidate the three-dimensional structure of these transporters.

  • Structure-Guided Mutagenesis: The partial rescue of the SLC30A9 phenotype by the H198A variant, but not the D323A variant, points to specific structural elements important for function . Systematic structure-guided mutagenesis could map functional domains and residues critical for zinc binding, transport, and regulation.

  • Conformational Changes During Transport: Understanding how zinc transporters change conformation during the transport cycle would provide mechanistic insights. Techniques like single-molecule FRET could capture these dynamic structural changes.

  • Protein-Protein Interaction Mapping: Identifying binding partners of zinc transporters through techniques like co-immunoprecipitation followed by mass spectrometry could reveal regulatory mechanisms and functional networks.

  • Comparative Structural Analysis: Comparing the structures of different zinc transporters (e.g., SLC30A9 vs. SLC39A9) could highlight conserved features essential for zinc transport as well as unique elements that determine substrate specificity and directionality.

These structural approaches would complement functional studies and provide a more comprehensive understanding of zinc transporter biology at the molecular level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.