Recombinant Pongo abelii Zinc transporter SLC39A7 (SLC39A7)

Shipped with Ice Packs
In Stock

Description

Introduction to SLC39A7/ZIP7 Transporters

SLC39A7, also known as ZIP7, belongs to the ZIP family of zinc transporters, which consists of 14 proteins responsible for transporting zinc into the cytoplasm. As a member of the solute carrier family 39, SLC39A7 plays a crucial role in maintaining zinc homeostasis within cells . This transmembrane protein primarily functions to control zinc transport from the endoplasmic reticulum (ER) and Golgi apparatus to the cytoplasm, serving as a gatekeeper for intracellular zinc release .

Zinc is an essential cofactor for more than 50 classes of enzymes and is involved in protein, nucleic acid, carbohydrate, and lipid metabolism. It also participates in controlling gene transcription, growth, development, and cellular differentiation . Due to its charged nature, zinc cannot passively diffuse across cell membranes and requires specific transporters like SLC39A7 to facilitate its movement between cellular compartments.

Role in Zinc Homeostasis

SLC39A7/ZIP7 serves as a critical regulator of zinc homeostasis, particularly within the ER. When ZIP7 is deficient, zinc accumulates in the ER, leading to ER stress . This dysregulation of zinc distribution affects numerous cellular processes dependent on proper zinc concentrations.

Genetic ablation studies have shown that SLC39A7/ZIP7 deficiency results in decreased cytosolic zinc levels, increased ER zinc levels, impaired cell proliferation, and induction of ER stress . These effects can be reversed by increasing cytosolic zinc levels, confirming the causal relationship between zinc transport dysregulation and cellular dysfunction.

Cell Signaling and Proliferation

SLC39A7/ZIP7 plays a significant role in cell signaling pathways that influence cell proliferation, survival, and migration. The activation of ZIP7 involves phosphorylation by protein kinase CK2 (formerly casein kinase 2) at specific residues, notably Ser275 and Ser276 in the human protein . This phosphorylation triggers the release of zinc from intracellular stores, primarily the ER.

The released zinc then activates multiple downstream signaling pathways, including:

  1. Tyrosine kinases

  2. Phosphorylation of AKT (protein kinase B)

  3. Activation of extracellular signal-regulated kinases 1 and 2 (ERK1/2)

These signaling cascades ultimately promote cell proliferation and migration, processes that are essential for normal tissue homeostasis but can also contribute to cancer progression when dysregulated.

Tissue-Specific Functions

Research on ZIP7's role in intestinal epithelium has shown that it is highly expressed in the intestinal crypt and is essential for intestinal epithelial proliferation . Studies with mice lacking Zip7 in the intestinal epithelium revealed:

  1. Triggered ER stress in proliferative progenitor cells

  2. Significant cell death of progenitor cells

  3. Loss of Olfm4+ intestinal stem cells

  4. Degeneration of post-mitotic Paneth cells

These findings indicate that ZIP7 is fundamentally required for homeostatic intestinal regeneration and maintenance of intestinal stem cells. The regulation of ER function in proliferative progenitor cells appears to be a key mechanism by which ZIP7 maintains intestinal epithelial homeostasis.

Implications in Disease

SLC39A7/ZIP7 has been implicated in several pathological conditions, most notably cancer. ZIP7 expression is elevated in various cancer types, including:

  1. Breast cancer (particularly in basal and Her2 subtypes)

  2. Colorectal cancer

  3. Cervical cancer

  4. Hepatocellular carcinoma

In breast cancer, ZIP7 hyperactivation has been linked to endocrine resistance, while in colorectal cancer, elevated ZIP7 expression correlates with adverse patient outcomes . In cervical cancer, ZIP7 influences epithelial-mesenchymal transition, a process crucial for metastasis. For hepatocellular carcinoma, inhibition of ZIP7 attenuates PI3K/AKT signaling, suppressing tumor cell growth, migration, and invasion .

Expression and Purification

The recombinant Pongo abelii SLC39A7 protein is produced in an in vitro E. coli expression system . The full-length protein (amino acids 1-469) includes an N-terminal 10xHis-tag to facilitate purification and detection. The protein is available in both liquid and lyophilized forms, with specific storage recommendations to maintain stability and activity .

Research Applications

Recombinant Pongo abelii SLC39A7 provides a valuable tool for studying zinc transport mechanisms in primate models. Potential applications include:

  1. Comparative studies of zinc transport across species

  2. Investigation of structure-function relationships in ZIP transporters

  3. Development of inhibitors or activators with potential therapeutic applications

  4. Study of post-translational modifications, particularly phosphorylation

  5. Analysis of protein-protein interactions involving ZIP7

Small molecule screening approaches have identified compounds capable of rescuing ER stress and cell proliferation in ZIP7-deficient cells , suggesting potential therapeutic strategies for conditions associated with ZIP7 dysfunction.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that specific tag.
Synonyms
SLC39A7; Zinc transporter SLC39A7; Histidine-rich membrane protein Ke4; Solute carrier family 39 member 7; Zrt-, Irt-like protein 7; ZIP7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-469
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SLC39A7
Target Protein Sequence
MARGLGAPHWVAVGLLTWATLGLLVAELGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSH AHGHGHTHESIWHGHTHGHDHGHSHGDLHHGHSHGHSHESLYHRGHGHDNEHSRGGYGES GAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGL LGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHV KGGHGHSHGHGHAHSHTHGSHGHGRQECSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGP VRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEV PHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVVMMVLIAHLE
Uniprot No.

Target Background

Function
Zinc transporter, responsible for transporting Zn(2+) from the endoplasmic reticulum/Golgi apparatus to the cytosol. Transport is stimulated by growth factors, such as EGF, and Ca(2+), as well as by exogenous Zn(2+).
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, KE4/Catsup subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is SLC39A7 and what is its role in zinc transport?

SLC39A7 (ZIP7) is a member of the Slc39a family of zinc transporters responsible for moving zinc into the cytosol from either the extracellular space or intracellular stores such as the endoplasmic reticulum (ER). It specifically functions as an ER-to-cytoplasm Zn²⁺ transporter, playing a critical role in maintaining proper zinc distribution between cellular compartments. This transporter is essential for normal growth and development in mammalian cells through its regulation of zinc homeostasis, which affects numerous cellular processes and signaling pathways. Studies using genetic ablation of SLC39A7 have demonstrated that it results in decreased cytosolic zinc levels, increased ER zinc levels, impaired cell proliferation, and induction of ER stress - all of which can be rescued by increasing cytosolic zinc levels .

How should recombinant Pongo abelii SLC39A7 be stored and handled for research applications?

For optimal stability and activity, recombinant Pongo abelii SLC39A7 should be stored in Tris-based buffer with 50% glycerol. Short-term storage should be at -20°C, while extended storage requires -20°C or -80°C conditions. Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can compromise protein integrity and functionality. This storage approach helps preserve the native conformation and activity of the protein for experimental applications .

How does SLC39A7 deficiency affect cellular functions?

SLC39A7 deficiency has profound effects on cellular function through alteration of zinc homeostasis. Research using knockdown cell lines shows that SLC39A7 deficiency results in:

  • Decreased cytosolic zinc levels and increased ER zinc concentration

  • Significantly reduced cell proliferation (measured via CCK8 assay after 4 days)

  • Reduced cell adherence after PMA stimulation

  • Induction of ER stress responses

  • Impaired classical M1 macrophage activation

These functional impairments can be reversed through zinc supplementation, confirming the causal relationship between zinc transport disruption and the observed cellular defects. Specifically, in SLC39A7-knockdown THP-1 cells, phagocytosis efficiency is significantly decreased, and the production of proinflammatory cytokines TNF-α and IL-6 is reduced compared to control cells .

What experimental approaches can be used to study SLC39A7 function?

Experimental ApproachApplicationKey Considerations
CRISPR-Cas9 gene editingGenerate SLC39A7-knockdown cell linesValidation of knockdown efficiency via Western blot with anti-SLC39A7 antibody
Cell Proliferation Assay (CCK8)Measure impact on cell growthSeed cells at 1.5×10⁴ cells/well, measure absorption at 450 nm at 24h, 48h, 72h, 96h
Zinc SupplementationRescue experimentsTitrate zinc concentrations to avoid toxicity
Cytokine Expression AnalysisEvaluate impact on immune functionMeasure both mRNA (qPCR) and protein levels (ELISA)
Surface Receptor ExpressionDetermine effects on phagocytosisAnalyze expression of receptors like Clec4e, TLR4, etc.

These methodological approaches have been successfully used to elucidate SLC39A7 function in various cellular contexts. For example, in one study, SLC39A7-knockdown cells showed reduced TNF-α and IL-6 secretion at 48h after BCG-p infection compared to control cells, and this reduction was reversible by zinc supplementation .

How does SLC39A7 influence gene expression and cell surface receptors?

SLC39A7 deficiency significantly impacts the expression of key cell surface receptors involved in immune function. Research demonstrates that SLC39A7 knockdown results in:

  • Significantly decreased mRNA levels of Clec4e (also known as Mincle), a receptor involved in phagocytosis

  • Increased expression of TLR4 mRNA

  • No significant change in expression of other surface receptors like DC-SIGN, MARCO, Dectin-1, and Clec4d

These alterations in gene expression can be reversed through zinc supplementation, with Clec4e expression increasing significantly and TLR4 expression decreasing when exogenous Zn²⁺ is added to the knockdown cells. This suggests that SLC39A7-mediated zinc transport plays a critical role in regulating the transcription of specific immune receptors, particularly those involved in phagocytosis and immune cell activation .

What is the relationship between SLC39A7 mutations and immunodeficiency disorders?

SLC39A7 (ZIP7) deficiency has been identified as the causative factor in a recently described form of congenital agammaglobulinemia with autosomal recessive inheritance. In this condition, developing B cells are particularly sensitive to altered zinc distribution, resulting in a developmental blockade beyond the pre-B cell stage. This sensitivity explains why ZIP7 deficiency manifests primarily as an immunological disorder.

Complete loss of ZIP7 function causes a reduction in cytoplasmic zinc and an increase in endoplasmic reticulum zinc concentration, disrupting the normal development of B cells. Clinically, patients with ZIP7 deficiency present with recurrent respiratory tract infections, meningitis, agammaglobulinemia, and B cell lymphopenia. For example, a recent case report identified a novel SLC39A7 variant in a patient with these clinical manifestations, expanding our understanding of the genetic basis of this rare immunodeficiency .

How can small-molecule screening approaches identify potential therapeutics for SLC39A7-related disorders?

Research has demonstrated the potential of small-molecule library screening for identifying compounds that can rescue cellular defects caused by SLC39A7 deficiency. In one study, researchers implemented a screening approach using 2,800 compounds to identify molecules capable of rescuing both ER stress and impaired cell proliferation in ZIP7-deficient cells. This screening successfully identified one small molecule effective in the low micromolar range.

The screening methodology relied on the robust cellular phenotypes of increased ER stress and impaired cell proliferation that result from ZIP7 deficiency. By using these phenotypes as readouts, researchers could efficiently identify compounds that restore normal cellular function despite the absence of functional SLC39A7. This approach demonstrates the potential for developing targeted therapeutics for patients with SLC39A7 mutations or related zinc transport disorders .

What experimental models best recapitulate SLC39A7-related pathologies?

Model SystemAdvantagesLimitationsKey Applications
CRISPR-modified cell linesPrecise genetic control, human cellsLimited to cellular phenotypesMolecular mechanism studies, drug screening
Patient-derived cellsDirect clinical relevanceLimited availability, heterogeneous backgroundsValidation of pathophysiological mechanisms
Conditional knockout miceIn vivo systemic effects, tissue interactionsSpecies differences, longer timeframeDevelopmental effects, systemic manifestations

For cellular models, THP-1 cells (human monocytic cell line) have been successfully used to study SLC39A7 function through CRISPR-Cas9 gene editing. These models show clear phenotypes including reduced proliferation, impaired phagocytosis, and altered cytokine production, making them valuable tools for mechanistic studies and therapeutic screening .

How do zinc transport dynamics differ between SLC39A7 and other zinc transporters?

SLC39A7 belongs to the SLC39A family (ZIP transporters) that generally transport zinc into the cytosol, while the SLC30A family mediates zinc efflux from the cytosol. What distinguishes SLC39A7 from many other zinc transporters is its specific localization to the endoplasmic reticulum membrane and its critical role in maintaining the zinc balance between the ER and cytosol.

While many other ZIP family members (such as ZIP1-4) primarily transport zinc from the extracellular space into the cytosol, SLC39A7 (ZIP7) specifically regulates the release of zinc from the ER stores into the cytoplasm. This specialized function places SLC39A7 at a critical juncture in cellular zinc homeostasis, as the ER is a major intracellular zinc storage site that affects numerous cellular processes including protein folding and secretion. Disruption of this specific transport pathway cannot be fully compensated by other zinc transporters, explaining the severe phenotypes observed in SLC39A7 deficiency .

What challenges exist in studying recombinant Pongo abelii SLC39A7 compared to human SLC39A7?

Studying Pongo abelii SLC39A7 presents several challenges compared to human SLC39A7, particularly in translating findings to human health applications. While the Pongo abelii version serves as an important comparative model, researchers must consider several factors:

  • Sequence variations between species may affect protein-protein interactions and regulatory mechanisms

  • Post-translational modifications might differ, potentially altering transport activity or regulation

  • Species-specific cellular environments may influence transporter function and localization

  • Antibody cross-reactivity must be carefully validated when using human-targeted antibodies

Although the fundamental zinc transport function is likely conserved, these differences necessitate careful validation of findings before extrapolating to human systems. Researchers should consider using complementary approaches with both species' proteins when possible and perform rigorous cross-species functional comparisons .

How can advanced imaging techniques enhance our understanding of SLC39A7 function?

Advanced imaging techniques offer powerful tools for investigating SLC39A7 function beyond traditional biochemical approaches. These methods can provide spatial and temporal resolution of zinc transport dynamics and SLC39A7 localization:

  • Fluorescent zinc probes: Genetically encoded or small-molecule zinc sensors can track zinc movement in real-time across cellular compartments, enabling direct visualization of SLC39A7-mediated zinc transport.

  • Super-resolution microscopy: Techniques like STORM or PALM can resolve SLC39A7 localization within the ER membrane at nanometer resolution, potentially revealing functional microdomains.

  • FRET-based approaches: By tagging SLC39A7 and interaction partners with appropriate fluorophores, conformational changes and protein-protein interactions can be monitored in living cells.

  • Correlative light and electron microscopy (CLEM): This approach can connect SLC39A7 function to ultrastructural changes in the ER and other organelles during zinc transport.

These advanced imaging approaches, combined with genetic manipulation of SLC39A7, can reveal the dynamic aspects of zinc transport that are difficult to capture with biochemical methods alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.