Recombinant Pongo abelii Zinc transporter ZIP9 (SLC39A9)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

AttributeDetail
Gene NameSLC39A9
Protein AliasZIP9, Zrt- and Irt-like protein 9
SpeciesPongo abelii (Sumatran orangutan)
Uniprot IDQ5RE57
Sequence Length241 amino acids (partial sequence)
Transmembrane DomainsPredicted 7 TM domains (intracellular C-terminus)

The recombinant protein lacks post-translational modifications due to cell-free expression systems, enabling precise structural studies .

Key Functional Roles

  • Zinc Transport: Mediates zinc influx into cells, critical for maintaining cytosolic zinc levels .

  • Signaling Regulation: Couples with G-proteins (e.g., Gs, Gi, Gnα11) to activate downstream kinases like Akt and Erk .

  • Membrane Androgen Receptor: Binds testosterone, inducing apoptosis in certain cell types .

Production Methodology

The recombinant Pongo abelii ZIP9 is produced via cell-free expression systems, which bypass limitations of traditional mammalian cell cultures . This method ensures:

  • High Purity: ≥85% purity, confirmed by SDS-PAGE .

  • Controlled Post-Translational Modifications: Absence of glycosylation or phosphorylation, ideal for structural studies .

Role in Zinc Homeostasis

ZIP9 regulates intracellular zinc levels by releasing zinc from organelles (e.g., Golgi) into the cytosol . In DT40 B-cell models, ZIP9 knockout led to:

  • Reduced Akt/Erk Phosphorylation: Impaired B-cell receptor (BCR) signaling .

  • Increased PTPase Activity: Enhanced protein tyrosine phosphatase (PTPase) activity, inhibiting kinase cascades .

Mechanistic Insights

ProcessZIP9’s Role
Zinc ReleaseTransports zinc from Golgi to cytosol, elevating local concentrations .
PTPase InhibitionZinc binding to PTPase active sites reduces enzymatic activity .
Kinase ActivationZinc-mediated inhibition of PTPase indirectly activates Akt/Erk .

Comparative Biology

The Pongo abelii ZIP9 shares 89% sequence identity with human ZIP9, making it a valuable model for studying evolutionary conservation of zinc transport mechanisms .

Future Directions

Recombinant Pongo abelii ZIP9 offers opportunities for:

  1. Structural Studies: Resolving discrepancies in transmembrane domain predictions (7 vs. 8 domains) .

  2. Therapeutic Targeting: Investigating ZIP9’s role in cancer or immune disorders, where zinc dysregulation is implicated .

  3. Evolutionary Biology: Tracing ZIP9’s functional divergence across primates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by factors including storage state, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC39A9; ZIP9; Zinc transporter ZIP9; Solute carrier family 39 member 9; Zrt- and Irt-like protein 9; ZIP-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SLC39A9
Target Protein Sequence
MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEDRLKLVTVLGAGLLCGTALAVIVPEGVH ALYEDILEDPEAARSSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHK APAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVMSMVTYLGLSKSSKEALSEVNATGVA MLFSAGTFLYVATVHVLPEVGGIGHSHKLDATGGRGLSRLEVAALVLGCLIPLILSVGHQ H
Uniprot No.

Target Background

Function
May act as a zinc-influx transporter.
Database Links

KEGG: pon:100171785

UniGene: Pab.3324

Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Zinc transporter ZIP9 (SLC39A9) and what is its significance in molecular biology?

Zinc transporter ZIP9 (SLC39A9) is a member of the ZIP (ZRT- and Irt-like Protein) family that regulates zinc homeostasis by facilitating zinc transport across cellular and organelle membranes into the cytoplasm. What makes ZIP9 particularly significant is its dual functionality - beyond zinc transport, it acts as a novel membrane androgen receptor (mAR) that mediates non-classical testosterone signaling . This dual functionality positions ZIP9 at the intersection of zinc metabolism and steroid hormone signaling, making it an important model for studying integrated cellular processes. In Pongo abelii (Sumatran orangutan), ZIP9 shares significant homology with human ZIP9, making it valuable for comparative evolutionary studies of zinc transport mechanisms and steroid signaling across primates .

What are the optimal handling conditions for recombinant Pongo abelii ZIP9?

Recombinant Pongo abelii ZIP9 requires specific handling to maintain structural integrity and functional activity. The lyophilized protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended for multiple use to avoid repeated freeze-thaw cycles . For reconstitution, the protein should be centrifuged briefly before opening to ensure contents settle at the bottom of the vial. The recommended reconstitution procedure involves using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

For long-term storage, adding glycerol to a final concentration of 5-50% (typically 50% is standard) before aliquoting and storing at -20°C to -80°C is recommended . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as it can compromise protein integrity and activity . These careful handling procedures are essential for maintaining the protein's native conformation and functional properties for experimental applications.

How can researchers effectively use recombinant Pongo abelii ZIP9 in functional studies?

Researchers can employ several methodological approaches to study recombinant Pongo abelii ZIP9 functionality:

Zinc Transport Assays:

  • Fluorescent zinc indicators (such as FluoZin-3) can measure intracellular zinc levels in cells transfected with recombinant ZIP9

  • Radioactive zinc (⁶⁵Zn) uptake assays can quantify transport kinetics

  • Zinc-sensitive transcription factor activation assays can indirectly measure zinc influx

Androgen Binding Studies:

  • Competitive binding assays using radiolabeled testosterone and recombinant ZIP9

  • Surface plasmon resonance to measure binding kinetics

  • Fluorescently-labeled androgen analog binding assays

For comparative studies with human ZIP9, researchers should develop parallel experimental systems expressing each protein under identical conditions. Key parameters to compare include zinc transport rates, androgen binding affinities, downstream signaling activation, and response to inhibitors . When designing such experiments, it's crucial to account for species-specific differences in post-translational modifications and folding that might affect protein function.

What methodologies are recommended for studying ZIP9-mediated signaling pathways?

ZIP9-mediated signaling should be investigated using multiple complementary approaches:

G-protein Coupling Analysis:

  • GTPγS binding assays to measure G-protein activation

  • Co-immunoprecipitation studies to identify G-protein interactions

  • BRET/FRET assays to monitor real-time protein interactions

Downstream Signaling Pathway Investigation:

  • Phosphorylation assays for MAPK activation following testosterone stimulation

  • YAP1 nuclear translocation measurements using immunofluorescence or fractionation approaches

  • cAMP assays (for Gs coupling) or inhibitory G-protein assays (for Gi coupling)

  • Calcium flux measurements for Gnα11 coupling

Research has demonstrated that ZIP9 couples to different G proteins in various cell types: Gs protein in granulosa cells, Gi protein in cancer cells, and Gnα11 in spermatogenic cells . Therefore, experimental design should account for cell-type specificity of signaling. Recombinant Pongo abelii ZIP9 can serve as a valuable tool for comparative analysis with human ZIP9 to identify conserved signaling mechanisms across species and potentially reveal evolutionary adaptations in signaling pathways .

How can researchers differentiate between ZIP9-mediated and classical androgen receptor-mediated effects?

Distinguishing ZIP9-mediated from classical androgen receptor (AR) effects requires strategic experimental design:

Cell Model Selection:

  • Use cell lines lacking classical AR expression (e.g., AR-negative PC-3 prostate cancer cells)

  • Generate isogenic cell lines with ZIP9 knockout/knockdown in AR-positive cells

  • Create cells expressing mutant forms of ZIP9 that retain zinc transport but lack androgen binding

Pharmacological Approaches:

  • Compare responses to non-aromatizable androgens (cannot be converted to estrogens)

  • Utilize membrane-impermeable testosterone conjugates that selectively activate membrane receptors

  • Apply selective inhibitors, noting that some classical AR inhibitors like bicalutamide can also antagonize ZIP9-mediated effects

Readout Specificity:

  • Focus on rapid signaling events (seconds to minutes) that are characteristic of membrane receptor activation

  • Monitor ZIP9-specific downstream pathways like zinc influx coupled to MAPK activation

  • Assess YAP1 nuclear translocation, which has been specifically linked to ZIP9 activity in melanoma

Studies have demonstrated that human ZIP9 functions as a membrane androgen receptor in triple-negative breast cancer MDA-MB-468 cells and AR-negative PC-3 prostate cells, mediating testosterone-induced apoptosis via MAPK- and zinc-dependent pathways . These methodological approaches provide a framework for investigating parallel functions in Pongo abelii ZIP9.

What is known about ZIP9's role in cancer, and how can recombinant ZIP9 advance this research?

ZIP9 has emerging significance in cancer biology with sex-specific implications:

Cancer Expression Patterns:

  • ZIP9 is upregulated in malignant breast and prostate tissues

  • ZIP9 expression correlates with testosterone-induced apoptosis in certain cancer cell types

  • ZIP9 has been identified as a druggable determinant of sex differences in melanoma

Experimental Applications of Recombinant ZIP9:

  • Develop screening assays for compounds that selectively modulate ZIP9 activity

  • Create structure-function studies to map domains responsible for zinc transport versus androgen binding

  • Generate antibodies against species-specific epitopes for immunohistochemical studies

  • Establish in vitro models comparing human and non-human primate ZIP9 responses to potential therapeutics

Research has demonstrated that in male mice, androgen receptor inhibitors suppressed growth of ZIP9-expressing melanomas but had no effect on isogenic melanomas lacking ZIP9 or on melanomas in females . This suggests that ZIP9 mediates sex-specific differences in melanoma progression. Recombinant Pongo abelii ZIP9 provides a valuable tool for comparative studies to determine evolutionary conservation of these mechanisms across primates.

What are the challenges in studying the dual functionality of ZIP9 as both a zinc transporter and androgen receptor?

Investigating ZIP9's dual functionality presents several methodological challenges:

Functional Coupling Complexity:

  • Determining whether zinc transport and androgen binding are mechanistically linked or independent functions

  • Identifying whether conformational changes upon androgen binding affect zinc transport rates

  • Establishing if zinc is required as a cofactor for androgen binding

Technical Challenges:

  • Developing assays that can simultaneously monitor both functions

  • Creating mutations that selectively disrupt one function while preserving the other

  • Accounting for the influence of cellular zinc status on androgen response, and vice versa

  • Maintaining proper folding and membrane insertion of recombinant protein in experimental systems

Experimental Approaches:

  • Site-directed mutagenesis targeting predicted androgen binding sites versus zinc coordination sites

  • Real-time monitoring of zinc influx immediately following testosterone application

  • Manipulating cellular zinc levels and measuring effects on androgen sensitivity

  • Comparing ZIP9 activity in different subcellular compartments

These challenges necessitate multidisciplinary approaches combining protein biochemistry, cell signaling, and structural biology. Recombinant Pongo abelii ZIP9 offers a comparative model to determine how these dual functions have evolved across species .

How does Pongo abelii ZIP9 compare structurally and functionally to human ZIP9?

A comparative analysis reveals both similarities and differences between Pongo abelii and human ZIP9:

Structural Comparison Table:

FeatureHuman ZIP9 (SLC39A9)Pongo abelii ZIP9 (SLC39A9)
Length (amino acids)307241 (may represent a specific isoform or domain)
Transmembrane domains8Likely 8 (predicted)
UniProt IDQ9NUM3Q5RE57
Key conserved motifsHEXPHEXGD zinc binding motifPresent (conserved across ZIP family)

Functional Considerations:

  • The conservation of key structural domains suggests similar zinc transport mechanisms

  • The androgen binding capability is likely conserved but may show species-specific affinity differences

  • G-protein coupling patterns may differ based on subtle structural variations

  • Post-translational modifications could differ between species, affecting regulation

Methodologically, researchers should compare both proteins under identical experimental conditions when exploring zinc transport kinetics, androgen binding affinities, and downstream signaling activation. Chimeric proteins combining domains from both species could help identify regions responsible for any functional differences observed .

What insights can comparative studies of ZIP9 across species provide for evolutionary biology?

Comparative studies of ZIP9 across species offer valuable evolutionary insights:

Evolutionary Conservation Patterns:

  • The dual functionality as zinc transporter and androgen receptor represents an interesting case of protein multifunctionality

  • Comparison across primates can reveal selection pressures on different functional domains

  • Species variations may correlate with differences in zinc metabolism or androgen responsiveness

Research Approaches:

  • Phylogenetic analysis of ZIP9 sequences across primates and other mammals

  • Functional characterization of recombinant ZIP9 from multiple species under standardized conditions

  • Structural modeling to identify species-specific variations in binding pockets or interaction surfaces

  • Investigation of species differences in expression patterns and tissue distribution

Evolutionary Questions Addressable:

  • Has the dual functionality of ZIP9 co-evolved or did one function emerge after the other?

  • Do species differences in ZIP9 correlate with dietary zinc availability during evolution?

  • Has sexual selection influenced the evolution of ZIP9's androgen-binding capacity?

  • Are there species-specific differences in the role of ZIP9 in sex-dependent cancer progression?

These comparative studies could provide insights into the evolutionary relationship between zinc metabolism and steroid hormone signaling, potentially revealing how these systems became integrated through shared molecular machinery .

What are the optimal expression systems for producing functional recombinant Pongo abelii ZIP9?

Selecting the appropriate expression system is critical for obtaining functional recombinant ZIP9:

Expression System Comparison:

Expression SystemAdvantagesLimitationsRecommendations
E. coliHigh yield, economical, established protocolsLimited post-translational modifications, challenging for membrane proteinsBest for soluble domains, requires optimization of detergents for full-length protein
Insect cellsBetter for membrane proteins, some post-translational modificationsMore complex, moderate yieldRecommended for full-length functional studies
Mammalian cellsNative-like post-translational modifications, proper foldingLower yield, expensive, time-consumingIdeal for functional studies requiring mammalian modifications
Cell-free systemsRapid, avoids toxicity issuesLimited scale, expensiveUseful for initial screening and optimization

Methodological Recommendations:

  • For structural studies: Use E. coli with fusion partners that enhance solubility, followed by proper refolding protocols

  • For functional studies: Insect or mammalian cell expression is preferred to maintain native conformation and activity

  • Tag selection considerations: N-terminal tags are less likely to interfere with C-terminal interactions

  • Detergent screening is essential for extracting and maintaining membrane protein structure

The search results indicate that recombinant Pongo abelii ZIP9 has been successfully expressed in E. coli with an N-terminal His tag , suggesting this system can produce the protein in sufficient quantity and quality for some research applications.

What analytical methods are most effective for assessing the quality and functional integrity of recombinant ZIP9?

Multiple analytical approaches should be employed to confirm quality and functionality:

Protein Quality Assessment:

  • SDS-PAGE and Western blotting to verify size and purity (>90% purity recommended)

  • Circular dichroism to assess secondary structure integrity, particularly important for transmembrane proteins

  • Dynamic light scattering to confirm monodispersity and absence of aggregation

  • Mass spectrometry to verify sequence integrity and identify post-translational modifications

Functional Verification Assays:

  • Zinc uptake assays using fluorescent indicators or isotopic zinc

  • Androgen binding assays using radioligand binding or surface plasmon resonance

  • G-protein activation assays to confirm receptor functionality

  • Conformational analysis upon ligand binding using intrinsic fluorescence or limited proteolysis

Stability Assessment:

  • Thermal shift assays to determine protein stability

  • Time-course activity measurements to assess functional half-life under various storage conditions

  • Freeze-thaw stability tests to establish optimal handling protocols

These analytical methods should be applied systematically to ensure that the recombinant protein maintains both structural integrity and dual functional activities. This is particularly important when comparing research findings across different studies using recombinant ZIP9 from different sources or with different tags .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.