Recombinant Pongo pygmaeus ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MNEDLFTPFTTPTVLGLPAAILVILFPPLLVPTSKHFINNRLITTQQWLIRLTLKQMMIT HNTKGRTWSLMLTSLIIFIASTNLLGLFPYSFTPTTQLSMNLAMAIPLWASTVAMGLRFK AKISLAHLLPQGTPTPLIPMLIIIETISLFIQPLALAVRLTANITAGHLLMHLIGSATLT MLTINLPLTLITLTILTLLTILEIAVALIQAYVFTLLVSLYLHDNS
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for generating ATP from ADP in the presence of a proton gradient across the membrane, which is established by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), encompassing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are interconnected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may directly participate in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in cellular metabolism?

MT-ATP6 (mitochondrial ATP synthase subunit a) is a protein encoded by the mitochondrial genome that forms one part of the ATP synthase complex (also known as Complex V). This enzyme is essential for normal mitochondrial function, serving as the final component of the oxidative phosphorylation pathway. Specifically, MT-ATP6 is part of the Fo domain of ATP synthase that forms a proton channel across the inner mitochondrial membrane. This channel allows positively charged protons to flow down their electrochemical gradient, which generates the energy required for the F1 domain to catalyze the conversion of adenosine diphosphate (ADP) to adenosine triphosphate (ATP), the cell's primary energy currency .

How does the structure of Pongo pygmaeus MT-ATP6 compare to human MT-ATP6?

Pongo pygmaeus (Bornean orangutan) MT-ATP6 shares significant sequence homology with human MT-ATP6, reflecting their evolutionary relationship. The Pongo pygmaeus MT-ATP6 protein consists of 226 amino acids and has been assigned the UniProt accession number Q95A26. The protein sequence includes multiple transmembrane domains that facilitate its function as part of the proton channel . Comparative analyses between human and orangutan MT-ATP6 can provide insights into conserved regions crucial for function and potentially variable regions that might affect species-specific differences in energy metabolism efficiency.

What are the optimal storage conditions for recombinant MT-ATP6 protein to maintain functionality?

For optimal preservation of recombinant Pongo pygmaeus MT-ATP6 protein integrity and function, storage at -20°C is recommended for short-term use, while -80°C is preferred for extended storage. The protein is typically provided in a Tris-based buffer with 50% glycerol optimized for stability. Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and activity loss. For working solutions, aliquots can be maintained at 4°C for up to one week . When handling the protein, it's advisable to keep samples on ice and minimize exposure to room temperature to prevent degradation.

What are the recommended methodologies for studying MT-ATP6 expression in different tissues?

For studying MT-ATP6 expression across tissues, researchers should employ a multi-faceted approach:

  • RNA Analysis: Northern blotting and strand-specific reverse transcription followed by quantitative PCR can detect the two transcripts of MT-ATP6 - the tricistronic mRNA containing MT-ATP8, MT-ATP6, and MT-CO3, and the shorter processed transcript .

  • Protein Detection: Western blotting with antibodies specific to MT-ATP6 or immunohistochemistry for tissue localization.

  • Heteroplasmy Assessment: Next-generation sequencing or PCR-RFLP (Restriction Fragment Length Polymorphism) analysis to determine the distribution of wild-type versus mutant MT-ATP6 across different tissues, as heteroplasmy levels can vary significantly .

  • Functional Analysis: Blue-native gel electrophoresis to analyze complex V assembly and microscale oxygraphy to measure basal respiration and ATP synthesis rates .

This comprehensive approach provides a more complete picture of MT-ATP6 expression patterns and functional implications across different tissue types.

How can researchers effectively create and validate cellular models for studying MT-ATP6 mutations?

Creating reliable cellular models for MT-ATP6 mutation studies requires several methodical steps:

  • Transmitochondrial Cybrid Cell Creation: This involves fusing enucleated cells containing the MT-ATP6 mutation of interest with ρ0 cells (cells depleted of mitochondrial DNA). This technique allows the study of mitochondrial mutations in a controlled nuclear background .

  • CRISPR-Cas9 Mitochondrial Genome Editing: Though challenging due to the difficulty of targeting the mitochondrial genome, newer techniques are emerging for direct editing of MT-ATP6.

  • Validation Methods:

    • Sequencing to confirm mutation presence

    • Heteroplasmy quantification across cell passages

    • Blue-native gel electrophoresis to assess complex V assembly

    • Microscale oxygraphy to measure respiratory capacity and ATP synthesis

    • Reactive oxygen species measurement to assess secondary effects

  • Functional Complementation: Expressing wild-type MT-ATP6 in mutant cells to confirm that observed phenotypes are directly attributable to the mutation.

These models provide essential platforms for understanding the pathophysiology of MT-ATP6 mutations and testing potential therapeutic approaches.

What techniques are most effective for assessing the functional impact of MT-ATP6 mutations on ATP synthesis?

To comprehensively evaluate how MT-ATP6 mutations affect ATP synthesis, researchers should implement the following methodology combination:

  • Microscale Oxygraphy: Using instruments such as Seahorse XF analyzers to measure oxygen consumption rate (OCR) under different conditions (basal, maximal, ATP-linked respiration) in cells harboring MT-ATP6 mutations compared to controls .

  • Luciferase-Based ATP Assays: Direct quantification of ATP levels in cellular extracts or mitochondrial fractions using luminescence-based detection.

  • Mitochondrial Membrane Potential Assessment: Using fluorescent dyes like TMRM (tetramethylrhodamine methyl ester) to evaluate the proton gradient that drives ATP synthesis.

  • Complex V Enzyme Activity Assays: Spectrophotometric measurement of ATP synthase activity in isolated mitochondria or mitochondrial fractions.

  • Proton Leak Analysis: Evaluating whether mutations cause proton leak across the inner mitochondrial membrane, which would reduce ATP synthesis efficiency.

These complementary approaches provide a comprehensive assessment of both the structural integrity of ATP synthase and its functional capacity for ATP production.

How do truncating mutations in MT-ATP6 affect mitochondrial function differently from missense mutations?

Truncating mutations in MT-ATP6 (like premature stop codons or frameshifts) generally cause more severe disruptions to mitochondrial function compared to missense mutations, though the effects depend on heteroplasmy levels and tissue distribution:

Truncating Mutations Effects:

  • Complete loss of functional domains critical for proton channel formation

  • Impaired complex V assembly, evidenced by multiple bands on blue-native gel electrophoresis

  • Significantly reduced basal respiration and ATP synthesis

  • Increased reactive oxygen species (ROS) production, potentially triggering oxidative stress

  • Activation of quality control mechanisms like the AFG3L2 protease complex to degrade truncated proteins

  • Potential impacts on processing and stability of other mitochondrial transcripts due to the overlapping nature of mitochondrial genes

Missense Mutations Effects:

  • Typically allow complex V assembly but may affect proton conductance

  • Variable effects on ATP synthesis depending on the specific amino acid change

  • Generally less severe ROS production increases

This differential impact explains why truncating mutations often associate with more severe clinical presentations, including early-onset encephalomyopathy, while missense mutations may present with later-onset, milder phenotypes.

What clinical phenotypes are associated with MT-ATP6 mutations, and how does heteroplasmy influence disease manifestation?

MT-ATP6 mutations are associated with a spectrum of clinical phenotypes, with disease severity and presentation strongly influenced by heteroplasmy levels (the proportion of mutant to wild-type mtDNA) in different tissues:

Clinical Phenotypes:

  • Leigh syndrome: Progressive brain disorder with developmental delay, movement problems, and respiratory difficulties (seen in approximately 10% of cases)

  • Cerebellar ataxia: Impaired coordination and balance

  • Neuropathy, ataxia, and retinitis pigmentosa (NARP)

  • Myoclonic epilepsy with cerebellar ataxia

  • Chronic kidney disease requiring transplantation

  • Leukodystrophy (white matter abnormalities)

  • Cognitive decline

  • Diabetes mellitus

Heteroplasmy Influence:

  • Threshold effect: Symptoms typically manifest when mutant load exceeds 70-90%

  • Tissue-specific thresholds: Tissues with high energy demands (brain, muscle, kidneys) show symptoms at lower heteroplasmy levels

  • Highly variable distribution: The same patient may show drastically different mutant loads across tissue types, complicating diagnosis and prognosis

  • Age-related changes: Heteroplasmy levels may shift over time, potentially explaining late-onset or progressive symptoms

This complex relationship between genetic mutation, heteroplasmy, and clinical manifestation necessitates comprehensive genetic analysis across multiple tissues when evaluating patients with suspected mitochondrial disorders.

How can researchers distinguish pathogenic variants from benign polymorphisms in MT-ATP6?

Distinguishing pathogenic MT-ATP6 variants from benign polymorphisms requires a multi-faceted approach combining computational, experimental, and clinical data:

Computational Assessment:

  • Conservation analysis across species (highly conserved residues are more likely to be pathogenic when mutated)

  • Prediction algorithms that evaluate the potential impact on protein structure and function

  • Population frequency databases - variants common in the general population are less likely to be pathogenic

Experimental Validation:

  • Transmitochondrial cybrid studies to isolate the effect of the mitochondrial variant

  • Blue-native gel electrophoresis to assess complex V assembly

  • Functional assays measuring ATP synthesis capacity, oxygen consumption, and ROS production

  • Protein stability and degradation studies to assess quality control responses

Clinical Correlation:

  • Segregation with disease in maternal lineage

  • Consistent clinical phenotype with known MT-ATP6 disorders

  • Heteroplasmy levels correlating with symptom severity

  • Tissue-specific distribution patterns matching affected organs

The gold standard approach involves creating cellular models carrying the variant of interest and demonstrating functional consequences on ATP synthase activity, as was done for confirming the pathogenicity of the m.8782G>A mutation .

How does the overlapping nature of MT-ATP6 with MT-ATP8 affect gene expression and protein synthesis?

The overlapping open reading frames of MT-ATP6 and MT-ATP8 create a complex genetic architecture that affects gene expression and protein synthesis in several ways:

  • Transcriptional Complexity: MT-ATP6 exists in two transcript forms - a tricistronic mRNA containing MT-ATP8, MT-ATP6, and MT-CO3, and a shorter processed transcript. Research using northern blotting and reverse transcription PCR has demonstrated that the tricistronic mRNA is predominantly associated with mitochondrial ribosomes, suggesting it serves as the primary template for translation .

  • Translational Regulation: The overlapping coding regions require sophisticated translational control to ensure proper production of both proteins. Mitochondrial ribosomes must initiate translation at two different start codons on the same transcript.

  • Mutational Consequences: Mutations in the overlapping region can affect both proteins simultaneously. For example, some mutations may alter MT-ATP8 while simultaneously creating a premature stop codon in MT-ATP6.

  • Evolutionary Conservation: This overlapping arrangement is evolutionarily conserved, suggesting functional significance, possibly in coordinating stoichiometric production of these interacting ATP synthase components.

  • Processing Mechanisms: Unlike canonical mitochondrial RNA processing by RNase P and RNase Z, the processing mechanism for the tricistronic transcript remains unestablished, representing a knowledge gap in our understanding of mitochondrial gene expression .

What role does the AFG3L2 protease complex play in quality control of MT-ATP6 nascent chains, and how might this be therapeutically targeted?

The AFG3L2 protease complex serves as a critical quality control mechanism for MT-ATP6 protein synthesis and membrane integration:

Functional Role:

  • Rapidly recognizes and degrades truncated or misfolded MT-ATP6 nascent chains

  • Works in coordination with the OXA1L-mediated membrane insertion pathway

  • Prevents accumulation of dysfunctional protein fragments that could interfere with complex V assembly

  • May help maintain appropriate stoichiometry of mitochondrial complexes

Mechanistic Details:

  • AFG3L2 is an m-AAA protease located in the inner mitochondrial membrane

  • It recognizes specific degradation signals in improperly integrated membrane proteins

  • The complex forms a hexameric ring structure with a central proteolytic chamber

  • ATP-dependent unfolding and translocation of substrates precedes proteolytic degradation

Therapeutic Implications:

  • Modulating AFG3L2 activity could potentially mitigate the effects of certain MT-ATP6 mutations

  • Enhancing AFG3L2 function might improve clearance of toxic truncated proteins

  • Conversely, temporary inhibition might allow some partially functional mutant proteins to accumulate

  • Targeting other quality control pathways might complement AFG3L2 function in managing proteostasis

This quality control system represents a potential therapeutic target, particularly for truncating MT-ATP6 mutations where enhanced clearance of dysfunctional proteins might improve mitochondrial function .

How do different cell types handle truncated MT-ATP6 proteins, and what explains the tissue-specific manifestations of MT-ATP6 mutations?

The cell type-specific responses to truncated MT-ATP6 proteins help explain the varied clinical manifestations of MT-ATP6 mutations:

Cell Type Differences in Handling Truncated MT-ATP6:

  • Different tissues show variable efficiency in recognizing and degrading truncated MT-ATP6 proteins through the AFG3L2 protease complex

  • Tissues differ in their capacity to upregulate compensatory pathways when ATP synthase function is compromised

  • Cellular differences in mitochondrial quality control mechanisms like mitophagy influence how effectively damaged mitochondria are eliminated

  • Variation in mitochondrial membrane composition across tissues affects the membrane insertion process of MT-ATP6

Tissue-Specific Manifestations Explanation:

  • Energy demand disparities: Tissues with high ATP requirements (brain, muscle, kidneys) are more vulnerable to ATP synthase deficiencies

  • Heteroplasmy distribution: Mutations show variable levels across tissues, creating a mosaic pattern of dysfunction

  • Compensatory capacity: Some tissues can better upregulate glycolysis or alternative energy pathways

  • Cell-specific protein quality control: The inherent ability of certain cell types to recognize and resolve impairments in mitochondrial protein synthesis contributes to the clinical spectrum

  • Developmental timing: Tissues forming during periods of high mutational burden may be more affected

This complex interplay explains why patients with identical MT-ATP6 mutations can present with different primary symptoms, ranging from neurological to renal or metabolic manifestations, and why tissue-specific approaches may be necessary for therapeutic development.

What experimental approaches can distinguish between primary effects of MT-ATP6 mutations and secondary consequences?

Distinguishing primary from secondary effects of MT-ATP6 mutations requires sophisticated experimental designs:

Experimental Approaches:

  • Time-Course Analysis:

    • Tracking cellular changes from early to late timepoints after introducing the mutation

    • Identifying which molecular alterations precede others in the pathogenic cascade

    • Temporal profiling of transcriptome, proteome, and metabolome changes

  • Transmitochondrial Cybrid Cells:

    • Comparing multiple independent cybrid lines with identical nuclear backgrounds but different MT-ATP6 mutations or heteroplasmy levels

    • This approach isolates mitochondrial genetic effects from nuclear variability

  • Rescue Experiments:

    • Allotopic expression of wild-type MT-ATP6 in mutant cells

    • Targeted pharmacological interventions at specific points in the pathway

    • Observing which phenotypes are directly reversed versus which require additional time or remain uncorrected

  • Multi-OMICS Integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify primary nodes versus downstream consequences

    • Flux analysis to determine metabolic rewiring patterns

  • In vitro Reconstitution:

    • Isolated complex V activity assays with purified components

    • Direct measurement of proton pumping capacity and ATP synthesis rates

    • Structural studies to assess primary conformational changes

These approaches help establish causative relationships between the mutation and observed phenotypes, which is critical for identifying the most promising therapeutic targets - those addressing primary rather than secondary effects of MT-ATP6 dysfunction.

How might comparative studies between human and Pongo pygmaeus MT-ATP6 inform our understanding of mitochondrial evolution and disease resistance?

Comparative studies between human and Pongo pygmaeus MT-ATP6 offer valuable insights into mitochondrial evolution and potentially species-specific disease resistance mechanisms:

  • Evolutionary Adaptation Analysis: Comparing the complete amino acid sequences of human and orangutan MT-ATP6 can reveal positively selected residues that might reflect adaptation to different metabolic demands or environmental conditions. The Pongo pygmaeus MT-ATP6 sequence (Q95A26) provides a basis for identifying conserved functional domains versus variable regions under different selective pressures .

  • Disease-Associated Sites: Mapping known human pathogenic variants onto the orangutan sequence may reveal sites where orangutans carry naturally occurring variants that would be pathogenic in humans, potentially indicating compensatory mechanisms that could inform therapeutic approaches.

  • Functional Divergence: Recombinant protein studies comparing human and orangutan MT-ATP6 could assess differences in:

    • Proton conductance efficiency

    • ATP synthesis rates under varying conditions

    • Resistance to oxidative stress

    • Protein stability and folding kinetics

  • Cybrid Cross-Species Studies: Creating hybrid cells containing human nuclear DNA but orangutan mitochondria could reveal compatibility mechanisms and species-specific nuclear-mitochondrial interactions that influence energy production efficiency.

This comparative approach may uncover novel therapeutic targets by identifying natural adaptations that protect against dysfunction in the ATP synthase complex, potentially informing the development of biomimetic treatments for human mitochondrial disorders.

What are the precise molecular mechanisms by which truncating MT-ATP6 mutations impact mitochondrial RNA processing and stability?

The impact of truncating MT-ATP6 mutations on mitochondrial RNA processing and stability involves several complex molecular mechanisms:

  • Disruption of RNA Secondary Structures: Truncating mutations may alter critical secondary structures in the polycistronic transcript that are recognition sites for RNA processing enzymes. For example, the m.9205delTA mutation appears to affect the processing of the tricistronic MT-ATP8/6/CO3 transcript, resulting in the absence of the shorter MT-ATP6 mRNA .

  • RNA Stability Elements: Mutations can disrupt binding sites for proteins that stabilize mitochondrial transcripts. Research with northern blotting has shown dramatic differences in transcript abundance between wild-type and mutant cells, suggesting altered RNA stability .

  • Ribosomal Association Patterns: Studies using sucrose density gradient fractionation and northern blotting have demonstrated that the tricistronic mRNA containing MT-ATP8/6/CO3 is the predominant transcript associated with the 55S mitochondrial monosome. Mutations that alter this association could affect translation efficiency .

  • Processing Enzyme Interactions: The non-canonical processing of the tricistronic transcript (not mediated by RNase P or RNase Z) suggests unique mechanisms that may be particularly vulnerable to sequence alterations .

  • Feedback Regulation: Truncated proteins may trigger feedback mechanisms that affect transcription and processing of mitochondrial RNAs, creating a complex regulatory network.

Understanding these mechanisms provides important insights into the broader consequences of MT-ATP6 mutations beyond just protein truncation, potentially explaining the variable expressivity of associated disorders.

How can researchers leverage recent advances in mitochondrial genome editing to develop therapeutic approaches for MT-ATP6-related disorders?

Recent advances in mitochondrial genome editing open promising avenues for developing therapies for MT-ATP6-related disorders:

  • Mitochondria-Targeted Nucleases:

    • Adaptation of CRISPR systems with mitochondrial localization signals

    • ZFNs (zinc finger nucleases) and TALENs (transcription activator-like effector nucleases) can be targeted to mitochondria

    • These approaches could potentially reduce heteroplasmy by selectively eliminating mutant mtDNA molecules

  • Base Editors and Prime Editors:

    • Modified CRISPR systems that can perform precise nucleotide changes without double-strand breaks

    • These could correct point mutations like m.8782G>A that cause truncating effects

    • Requires optimization of mitochondrial targeting and efficiency

  • RNA-Based Approaches:

    • Antisense oligonucleotides targeted to mutant mtRNA

    • Potential for modulating RNA processing to favor functional transcripts

    • RNA editing to correct mutations at the transcript level

  • Allotopic Expression:

    • Nuclear expression of recombinant MT-ATP6 with mitochondrial targeting

    • Could bypass the need for mitochondrial genome editing

    • Challenges include proper integration into complex V

  • Heteroplasmy Shifting:

    • Selective inhibition of mutant mtDNA replication

    • Mitochondrially-targeted restriction endonucleases specific for mutant sequences

    • Requires careful monitoring to maintain sufficient mtDNA copy number

  • Pharmacological Approaches:

    • Compounds that enhance residual ATP synthase activity

    • Modulators of the AFG3L2 protease complex to optimize quality control

    • Metabolic bypasses to provide alternative ATP sources

These approaches represent the cutting edge of mitochondrial medicine and offer hope for treating previously untreatable MT-ATP6-related disorders through precision genetic or molecular interventions.

What are the optimal methods for quantifying heteroplasmy in MT-ATP6 mutations across different tissue samples?

Accurate heteroplasmy quantification is essential for MT-ATP6 mutation research, with several methodological approaches offering different advantages:

Next-Generation Sequencing (NGS):

  • Provides the most comprehensive and accurate heteroplasmy quantification

  • Can detect low-level heteroplasmy (≥1%)

  • Allows simultaneous analysis of multiple mtDNA regions

  • Recommended workflow:

    • Long-range PCR to amplify mtDNA

    • Library preparation with unique molecular identifiers

    • Deep sequencing (>1000× coverage)

    • Bioinformatic filtering to distinguish true variants from sequencing errors

Digital Droplet PCR (ddPCR):

  • High sensitivity and specificity

  • Absolute quantification without standard curves

  • Less prone to amplification bias

  • Particularly useful for known mutations with established assays

  • Best for routine monitoring of specific mutations

Pyrosequencing:

  • Good for intermediate-range heteroplasmy (10-90%)

  • Relatively quick turnaround time

  • Less expensive than NGS for targeted analysis

  • Works well for specific, known mutations

PCR-RFLP (Restriction Fragment Length Polymorphism):

  • Suitable for mutations that create or abolish restriction sites

  • Less sensitive (detection limit ~5-10% heteroplasmy)

  • More accessible for laboratories with limited resources

  • Best for rough estimation or screening

For comprehensive MT-ATP6 research, tissue selection is equally important, with multiple tissues (blood, urine sediment, buccal cells, muscle) recommended for analysis due to the significant variation in heteroplasmy levels across tissues. This variability is a critical consideration for accurate diagnosis and phenotype correlation .

What controls and validation steps are essential when working with recombinant MT-ATP6 proteins in functional studies?

When conducting functional studies with recombinant MT-ATP6 proteins, several critical controls and validation steps must be implemented to ensure reliable and reproducible results:

Protein Quality Controls:

  • Purity Assessment: SDS-PAGE and Western blotting to confirm single-band purity and identity

  • Mass Spectrometry: To verify the exact protein sequence and post-translational modifications

  • Size-Exclusion Chromatography: To confirm proper oligomerization state

  • Circular Dichroism: To assess secondary structure content, especially important for membrane proteins

  • Storage Stability Testing: Regular activity checks during storage to establish reliable working periods

Functional Validation:

  • Reconstitution Controls: Comparing activity in lipid bilayers versus detergent micelles

  • Complementation Assays: Testing if the recombinant protein restores function in deficient systems

  • Dose-Response Relationships: Establishing linear ranges for activity assays

  • Alternative ATP Synthase Activity Measurements: Using multiple independent methods to confirm findings

  • Inhibitor Sensitivity: Response to known ATP synthase inhibitors (oligomycin, DCCD) as functionality markers

Experimental Design Controls:

  • Wild-Type Comparisons: Always include wild-type protein controls

  • Known Mutant Controls: Include well-characterized mutants as reference points

  • Tagging Controls: Compare tagged versus untagged proteins to assess tag interference

  • Environmental Sensitivity: Test function across pH, temperature, and ionic strength conditions

  • Thermal Stability Assays: Differential scanning calorimetry to assess structural integrity

These rigorous controls ensure that observed functional differences represent true biological phenomena rather than experimental artifacts, especially important when comparing wild-type Pongo pygmaeus MT-ATP6 with mutant variants or human orthologs.

What bioinformatic tools and databases are most valuable for researchers studying MT-ATP6 structure, function, and evolution?

Researchers studying MT-ATP6 can leverage several specialized bioinformatic tools and databases that provide valuable insights into structure, function, and evolution:

Sequence and Mutation Databases:

  • MitoMap (https://www.mitomap.org): Comprehensive database of human mitochondrial DNA mutations and polymorphisms, with specific information on MT-ATP6 variants

  • HmtDB (Human Mitochondrial Database): Collection of human mitochondrial genomes with population and variability data

  • MitoMiner: Integrated database of mitochondrial proteomics, linking mitochondrial genes to proteins and disease

  • UniProt (https://www.uniprot.org): Essential for accessing curated information on MT-ATP6 across species, including the Pongo pygmaeus entry (Q95A26)

Structural Analysis Tools:

  • AlphaFold DB: Provides predicted structures for MT-ATP6 across species

  • SWISS-MODEL: For homology modeling of MT-ATP6 variants

  • HMMTOP/TMHMM: Transmembrane helix prediction tools crucial for membrane proteins like MT-ATP6

  • ConSurf: Analysis of evolutionary conservation mapped onto protein structures

  • MutationAssessor: Predicts the functional impact of amino acid substitutions

Evolutionary Analysis Tools:

  • PhyloTree: Mitochondrial DNA haplogroup reference phylogeny

  • PAML: For detecting selection pressure on mitochondrial genes

  • MitoPhAST: Streamlined pipeline for mitochondrial phylogenomics

  • MEGA: Software for comparative sequence analysis and molecular evolution

Functional Prediction Tools:

  • MitImpact: Pathogenicity prediction of mitochondrial variants

  • PolyPhen/SIFT: For assessing functional impacts of amino acid changes

  • MutPred: Machine learning approach to predict pathogenicity of mtDNA mutations

  • APOGEE: ATP production prediction from genetic information

These resources collectively enable comprehensive analysis of MT-ATP6, from basic sequence comparison to sophisticated evolutionary studies and pathogenicity prediction, supporting both fundamental research and clinical applications focused on mitochondrial disorders.

How should researchers interpret contradictory results between in vitro biochemical assays and in vivo phenotypes for MT-ATP6 variants?

When faced with discrepancies between in vitro biochemical data and in vivo phenotypes for MT-ATP6 variants, researchers should employ a systematic analytical approach:

Sources of Discrepancies:

  • Heteroplasmy Effects: In vitro systems often use homoplasmic models that don't reflect the heteroplasmic reality in patients' tissues, where mutation load varies

  • Compensatory Mechanisms: Living systems activate adaptive responses absent in biochemical assays

  • Tissue-Specific Factors: Biochemical assays may not incorporate tissue-specific nuclear factors that modify MT-ATP6 function

  • Temporal Dynamics: Acute effects measured in vitro may differ from chronic adaptations in vivo

  • Secondary Effects: In vivo phenotypes often reflect downstream consequences beyond primary ATP synthase dysfunction

Interpretation Framework:

  • Context Assessment:

    • Evaluate the cellular context of biochemical assays (isolated enzymes, mitochondria, cells)

    • Consider the specific tissues examined in vivo and their energy dependencies

    • Account for developmental timing and age-related factors

  • Mechanistic Integration:

    • Develop integrated models that connect primary biochemical defects to secondary consequences

    • Consider effects on mitochondrial quality control systems like the AFG3L2 protease complex

    • Evaluate potential retrograde signaling effects from mitochondria to nucleus

  • Validation Approaches:

    • Use transmitochondrial cybrid models to bridge in vitro and in vivo findings

    • Apply multi-omics approaches to identify compensatory pathways

    • Develop tissue-specific models that better recapitulate in vivo conditions

When properly contextualized, apparent contradictions often reveal important insights about compensatory mechanisms, threshold effects, and tissue-specific vulnerabilities that advance our understanding of mitochondrial disease pathophysiology.

What statistical approaches are most appropriate for analyzing heteroplasmy-dependent effects of MT-ATP6 mutations?

Analyzing heteroplasmy-dependent effects of MT-ATP6 mutations requires specialized statistical approaches that account for the unique characteristics of mitochondrial genetics:

Recommended Statistical Approaches:

  • Non-Linear Regression Models:

    • Sigmoid or threshold models for determining biochemical thresholds

    • Logistic regression for binary outcomes (disease present/absent)

    • Piecewise regression to identify critical heteroplasmy breakpoints

  • Mixed-Effects Models:

    • Account for within-subject correlation across tissues

    • Incorporate random effects for patient-specific factors

    • Allow for varying slopes of heteroplasmy effects between individuals or tissues

  • Survival Analysis:

    • Time-to-event analysis using Cox proportional hazards models

    • Incorporating heteroplasmy as a time-varying covariate

    • Competing risk analyses for multiple possible outcomes

  • Bayesian Approaches:

    • Prior incorporation of known biological constraints

    • Hierarchical modeling for tissue-specific effects

    • Accounting for measurement uncertainty in heteroplasmy quantification

Key Statistical Considerations:

  • Threshold Determination:

    • Methods to identify critical heteroplasmy levels that trigger dysfunction

    • Changepoint analysis to detect shifts in phenotypic expression

    • Bootstrap methods to obtain confidence intervals for threshold estimates

  • Tissue-Specific Analysis:

    • Multi-level models accounting for tissue-specific sensitivity

    • Covariance structure modeling for relationships between tissues

    • Weighted analyses based on tissue relevance to clinical manifestations

  • Longitudinal Considerations:

    • Modeling heteroplasmy drift over time

    • Growth curve analysis for progressive phenotypes

    • Analysis of rate-of-change rather than absolute values

These tailored statistical approaches allow researchers to properly characterize the complex relationship between heteroplasmy levels and phenotypic outcomes, accounting for the unique aspects of mitochondrial genetics that standard statistical methods might overlook .

How can researchers differentiate between primary pathogenic effects and compensatory responses when analyzing transcriptomic or proteomic data in MT-ATP6 studies?

Differentiating primary pathogenic effects from compensatory responses in -omics data requires sophisticated analytical approaches:

Analytical Strategies:

  • Temporal Profiling:

    • Early timepoint changes likely represent primary effects

    • Late timepoint-only changes suggest compensatory responses

    • Time-series analysis to establish cause-effect relationships

    • Mathematical modeling of response kinetics

  • Dose-Response Relationships:

    • Primary effects typically show linear relationships with heteroplasmy levels

    • Compensatory responses often show threshold effects or non-linear relationships

    • Analysis of heteroplasmy correlation patterns across -omics features

  • Network Analysis Approaches:

    • Pathway enrichment to identify coordinated responses

    • Transcription factor activity analysis to identify regulatory mechanisms

    • Protein-protein interaction networks to map functional relationships

    • Bayesian network inference to establish causality

  • Cross-System Comparison:

    • Compare data from different experimental systems (cell lines, tissues, organisms)

    • Primary effects tend to be consistent across systems

    • Compensatory responses may be system-specific

    • Meta-analysis approaches to identify core responses

  • Perturbation Analysis:

    • Responses reversed by correcting the primary defect are likely compensatory

    • Effects of specifically blocking suspected compensatory pathways

    • Drug challenge experiments targeting specific components

    • Genetic manipulations to isolate pathway contributions

Computational Methods:

  • Differential Correlation Analysis:

    • Identify changes in correlation structure between genes/proteins

    • Network rewiring often indicates compensatory adaptation

  • Causal Reasoning Algorithms:

    • Infer directionality in regulatory networks

    • Distinguish upstream drivers from downstream consequences

  • Flux Balance Analysis:

    • Model metabolic network rewiring

    • Identify alternative pathways activated to maintain ATP production

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics

    • Look for concordant vs. discordant changes across data types

    • Integrate with knowledge of quality control mechanisms such as the AFG3L2 protease complex

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.