Recombinant Pongo pygmaeus C5a anaphylatoxin chemotactic receptor (C5AR1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

C5AR1 (UniProt ID: P79234) is a G protein-coupled receptor (GPCR) that binds the complement activation fragment C5a, triggering downstream inflammatory and chemotactic responses . The recombinant Pongo pygmaeus variant comprises the full-length 340-amino acid sequence fused to an N-terminal His tag for purification .

PropertySpecification
SpeciesPongo pygmaeus (Bornean orangutan)
Expression SystemEscherichia coli
Protein Length1–340 amino acids
TagHis-tag
Purity>90% (SDS-PAGE)
Storage Conditions-20°C/-80°C in lyophilized form; reconstituted aliquots stable at 4°C for 1 week
Reconstitution BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)

Amino Acid Sequence:
TPDYEHYDDNDMLDANTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACRILPSLILLNMYASILLLATISADRFLLVFNPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDHGHDKRRERAVAIVRLVLGFVWPLLTLTICYTFLLLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGMMMSFLEPSSPTFLLLKKLDSLCISFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKT .

Production and Functional Insights

The protein is expressed in E. coli, purified via affinity chromatography using its His-tag, and lyophilized for stability . Key functional attributes include:

  • Ligand Binding: C5AR1 activation drives Gαi protein coupling, β-arrestin recruitment, and calcium mobilization, critical for chemotaxis and cytokine secretion .

  • Thermostability: Structural studies on human C5AR1 (PDB ID: 5O9H) reveal a seven-transmembrane helical arrangement stabilized by disulfide bonds (Cys109–Cys188) . While the orangutan variant’s structure remains uncharacterized, its sequence homology suggests similar ligand-binding pockets.

Applications:

  • SDS-PAGE analysis for purity validation .

  • Antigen production for antibody development .

  • In vitro assays to study C5a-mediated immune responses .

Comparative Analysis with Orthologs

C5AR1 is evolutionarily conserved, with functional parallels across species:

SpeciesKey FeaturesResearch Applications
Human (P21730)Linked to food allergies, cancer, and neurodegenerative diseases .Drug development (e.g., PMX205 antagonist) .
MouseC5ar1−/− models show reduced IgE-mediated anaphylaxis and tumor growth .Mechanistic studies in allergy and oncology .
ZebrafishRole in developmental immunity .Embryonic immune system research .

The Pongo pygmaeus variant provides a primate-specific model for:

  • Cross-species complement system comparisons.

  • Preclinical testing of therapeutics targeting C5a signaling .

Research Limitations and Future Directions

While the recombinant Pongo pygmaeus C5AR1 is biochemically validated, peer-reviewed studies directly utilizing this protein are scarce. Most functional insights are extrapolated from human or murine models . Future work could focus on:

  • Structural characterization via cryo-EM or crystallography.

  • In vivo studies in primate models of inflammation or infection.

  • Comparative ligand-binding assays with human C5AR1 antagonists like NDT9513727 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us and we will prioritize its inclusion in the production process.
Synonyms
C5AR1; C5AR; C5R1; C5a anaphylatoxin chemotactic receptor 1; C5a anaphylatoxin chemotactic receptor; C5a-R; C5aR; CD antigen CD88; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
TPDYEHYDDNDMLDANTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAK RTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACRILPSLILLNMYASILLL ATISADRFLLVFNPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVL CGVDHGHDKRRERAVAIVRLVLGFVWPLLTLTICYTFLLLRTWSRRATRSTKTLKVVVAV VASFFIFWLPYQVTGMMMSFLEPSSPTFLLLKKLDSLCISFAYINCCINPIIYVVAGQGF QGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKT
Uniprot No.

Target Background

Function
The C5a anaphylatoxin chemotactic receptor (C5AR1) serves as a receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus and a second site in the transmembrane region responsible for activating downstream signaling events. Upon receptor activation, various cellular responses are triggered, including chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle.

Q&A

What is the structural composition of recombinant Pongo pygmaeus C5AR1?

Recombinant Pongo pygmaeus C5AR1 is a full-length protein (340 amino acids) that functions as a G protein-coupled receptor involved in complement activation. The protein structure includes:

  • Complete amino acid sequence (1-340aa): TPDYEHYDDNDMLDANTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACRILPSLILLNMYASILLLATISADRFLLVFNPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDHGHDKRRERAVAIVRLVLGFVWPLLTLTICYTFLLLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGMMMSFLEPSSPTFLLLKKLDSLCISFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKT

  • For research applications, the recombinant protein typically includes an N-terminal His-tag to facilitate purification and detection

  • When expressed in E. coli, the protein is typically provided as a lyophilized powder with >90% purity as determined by SDS-PAGE

The structural composition influences the protein's function in immune signaling, particularly its ability to bind C5a and initiate downstream inflammatory cascades. Researchers should note that specific protein modifications (such as His-tagging) might affect certain functional assays.

How does Pongo pygmaeus C5AR1 compare to human C5AR1 in terms of sequence homology and functional conservation?

While the search results don't explicitly compare Pongo pygmaeus and human C5AR1 sequences, comparative analysis is essential for researchers using orangutan models. Based on evolutionary conservation patterns observed in complement receptors:

  • Great apes typically show high sequence homology to human complement receptors (often >95%), with most differences concentrated in non-functional regions

  • Critical binding domains, particularly the three-site binding mode described for human C5AR1, are likely conserved in Pongo pygmaeus

  • The key activation mechanisms, including ligand recognition patterns and G protein coupling interfaces, are anticipated to be highly similar between species

For researchers, this means that findings regarding binding patterns, activation mechanisms, and downstream signaling observed with Pongo pygmaeus C5AR1 are likely to have translational relevance to human biology, though species-specific differences should be validated experimentally when making cross-species extrapolations.

What are the recommended storage conditions for maintaining the stability of recombinant Pongo pygmaeus C5AR1?

Proper storage is critical for maintaining protein functionality in experimental systems. For recombinant Pongo pygmaeus C5AR1:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles (which significantly decrease activity)

  • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to 5-50% (final concentration) is recommended for long-term storage; 50% is the standard recommendation

  • Storage buffer typically consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0

These storage conditions maintain protein structure and function by preventing degradation, denaturation, and aggregation that can occur with improper handling or repeated freeze-thaw cycles.

How does the three-site binding mechanism of C5a to C5AR1 influence experimental design when studying receptor activation?

The three-site binding mode of C5a to C5AR1 represents a complex interaction pattern beyond the traditional two-site model and has significant implications for experimental design. Research on human C5AR1 has revealed:

  • Site 1: Involves the membrane-proximal N-terminal region of C5AR1 interacting with the positively charged H2-H4 cavity of C5a through electrostatic interactions and van der Waals forces

  • Site 2: The C-terminal region of C5a penetrates deeply into the transmembrane helical bundle of C5AR1, with specific interactions involving ECL2 and TM4-TM7

  • Site 3: A novel binding site where the C5AR1 extracellular loop 2 region occupies the C5a cavity and packs with H1 and H2 of C5a, further stabilizing receptor activation

When designing experiments to study Pongo pygmaeus C5AR1 activation:

  • Use multiple ligands targeting different binding sites when assessing receptor functionality

  • Consider partial agonists or site-specific modulators to dissect the contribution of each binding site to receptor activation

  • Include mutations that specifically disrupt individual binding sites (e.g., D282A mutation disrupts a critical hydrogen bond at site 2)

  • Employ biophysical techniques (e.g., BRET, FRET) to assess conformational changes associated with partial vs. complete binding

This understanding allows for more sophisticated experimental designs that can differentiate between various activation states and signaling outcomes based on specific binding modes.

What is the significance of biased signaling in C5AR1 and how can it be experimentally measured in the Pongo pygmaeus receptor?

Biased signaling in C5AR1 refers to the ability of different ligands to preferentially activate specific downstream signaling pathways (G protein vs. β-arrestin). This has profound implications for developing targeted therapeutics with desired effects while minimizing unwanted outcomes.

The significance of biased signaling in C5AR1:

  • Can dictate the balance between protective vs. pathological immune responses

  • Allows for selective modulation of specific cellular responses (e.g., chemotaxis vs. inflammatory cytokine production)

  • Provides opportunities for developing functionally selective therapeutics with improved side effect profiles

Experimental approaches to measure biased signaling in Pongo pygmaeus C5AR1:

  • Pathway-specific assays:

    • G protein pathway: GTPγS binding assays, cAMP assays (Gi coupling reduces cAMP), and calcium mobilization assays

    • β-arrestin pathway: β-arrestin recruitment assays using bioluminescence resonance energy transfer (BRET) or enzyme complementation technologies

  • Comparative analysis using reference compounds:

    • Utilize C5a (balanced agonist) vs. C5a peptide derivatives (G protein-biased)

    • Calculate bias factors using operational models that compare relative efficacy between pathways

  • Receptor phosphorylation patterns:

    • Assess phosphorylation at specific serine/threonine residues using phospho-specific antibodies

    • Correlate phosphorylation patterns with pathway activation

  • Gene expression profiling:

    • Compare transcriptional responses downstream of different signaling pathways

    • Identify pathway-specific gene signatures using RNA-seq or targeted gene expression analysis

Understanding biased signaling is particularly relevant when studying the therapeutic potential of C5AR1 antagonists, as seen with compounds like PMX205 in neuroinflammatory conditions .

What is the role of specific amino acid residues in the C5AR1 activation mechanism, and how does this inform mutagenesis studies?

Critical amino acid residues play essential roles in C5AR1 ligand binding and activation. Based on structural and functional studies:

Residue PositionFunctionEffect of MutationExperimental Application
D191 (ECL2)Forms hydrogen bonds with main chains of ligandsReduces ligand binding affinityValidate binding mode of novel ligands
R175 (4.64)Stabilizes hooked C-termini of ligandsDisrupts ligand engagementStudy receptor conformational changes
Y258 (6.51)Forms cation-π interaction with R8 of ligandsImpairs ligand recognitionEngineer ligand specificity
D282 (7.35)Critical hydrogen bond with R8 in ligandsSignificantly impairs activationDesign activation-deficient control constructs
I116Component of activation interfaceI116A mutation alters activation propertiesStudy partial vs. full activation states

These key residues inform mutagenesis approaches for structure-function studies:

  • Alanine scanning of key interface residues to assess their contribution to ligand binding and receptor activation

  • Conservative vs. non-conservative substitutions to probe specific chemical interactions

  • Chimeric receptors (human/orangutan) to identify species-specific functional domains

  • Introduction of reporter residues (e.g., cysteine residues for crosslinking or fluorescent labeling) at strategic positions to monitor conformational changes

The D282A mutation in particular has been shown to significantly impair the efficacy of both C5a- and C5a peptide-mediated activation, highlighting its critical role in receptor function . This knowledge is crucial for designing mutant receptors to study specific aspects of C5AR1 signaling or to create control constructs for validating experimental observations.

What are the optimal expression systems for producing functional recombinant Pongo pygmaeus C5AR1 for different experimental applications?

Different expression systems offer distinct advantages and limitations for C5AR1 production:

  • E. coli expression system (as used in search result ):

    • Advantages: High protein yield, cost-effective, rapid production

    • Limitations: Lacks post-translational modifications, potential for improper folding of membrane proteins

    • Best for: Structural studies requiring large protein quantities, production of protein fragments for binding studies

    • Special considerations: Requires refolding protocols; typically yields non-glycosylated protein

  • Mammalian cell expression (HEK293, CHO):

    • Advantages: Proper folding, post-translational modifications, native-like receptor functionality

    • Limitations: Lower yield, higher cost, more complex protocols

    • Best for: Functional studies, cell-based assays, signaling studies

    • Special considerations: Stable vs. transient transfection choices affect expression levels and timing

  • Insect cell expression (Sf9, High Five):

    • Advantages: Higher yield than mammalian systems, proper folding, some post-translational modifications

    • Limitations: Glycosylation patterns differ from mammalian cells

    • Best for: Balance between protein yield and functionality, structural biology applications

    • Special considerations: Baculovirus optimization can significantly impact yields

For cell-based functional assays, transfection of mammalian cells with Pongo pygmaeus C5AR1 expression constructs is recommended, while structural studies might benefit from insect cell or E. coli expression systems. The choice of expression system should be guided by the specific experimental requirements and the importance of post-translational modifications for the intended application.

How can researchers effectively assess the functional activity of recombinant Pongo pygmaeus C5AR1 in experimental systems?

Multiple complementary approaches can validate the functional activity of recombinant C5AR1:

  • Ligand binding assays:

    • Radioligand binding using 125I-labeled C5a to determine Kd and Bmax values

    • Competition binding assays with labeled and unlabeled ligands

    • Surface plasmon resonance (SPR) to measure binding kinetics

  • Signal transduction assays:

    • G protein activation: [35S]GTPγS binding assay

    • Calcium mobilization assays using fluorescent indicators

    • cAMP inhibition assays (C5AR1 couples to Gi, inhibiting cAMP production)

    • ERK1/2 phosphorylation by Western blot or ELISA

  • Receptor trafficking studies:

    • Internalization assays using fluorescently-labeled C5a

    • Surface expression measurements by flow cytometry

    • Live-cell imaging with fluorescently-tagged receptor constructs

  • Functional cellular responses:

    • Chemotaxis assays measuring cell migration toward C5a gradients

    • ROS production measurement

    • Cytokine release quantification

  • Conformational studies:

    • BRET/FRET biosensors to detect conformational changes

    • Limited proteolysis accessibility to assess structural integrity

A comprehensive assessment should include multiple assays spanning different aspects of receptor function. For example, combining ligand binding data with downstream signaling measurement provides stronger evidence of proper receptor function than either measurement alone.

What are the key considerations for designing C5AR1 antagonism experiments in disease models?

When designing experiments to evaluate C5AR1 antagonism, researchers should consider:

  • Antagonist selection and validation:

    • Ensure antagonist specificity through multiple controls (structurally related inactive compounds)

    • Determine antagonist pharmacokinetics and appropriate dosing regimens

    • Validate target engagement in the specific model/tissue

  • Model selection:

    • Choose disease models with established C5AR1 involvement

    • Consider timing of intervention relative to disease stage

    • Account for species differences in antagonist potency

  • Control groups design:

    • Include proper vehicle controls and dosage ranges

    • Consider positive controls (e.g., broad immunosuppressants)

    • Include C5aR1 knockout controls where feasible

  • Outcome measurements:

    • Measure direct antagonist effects (receptor occupancy, signaling inhibition)

    • Assess disease-specific endpoints (e.g., neuroinflammation, glial responses)

    • Include both cellular and functional/behavioral outcomes

  • Cell-type specific considerations:

    • Determine C5AR1 expression patterns across relevant cell types

    • Use cell-type specific markers to correlate antagonist effects with cellular responses

    • Consider the role of C5AR1 in different cell populations (e.g., neutrophils vs. microglia)

For example, in neuroinflammatory models, the C5AR1 antagonist PMX205 has been shown to prevent cognitive loss, limit detrimental glial polarization while permitting neuroprotective responses . This demonstrates the importance of comprehensive outcome assessment beyond simple receptor occupancy or general anti-inflammatory effects.

How should researchers interpret apparent contradictions in C5AR1 function across different disease models?

C5AR1 shows context-dependent effects that can appear contradictory across different disease models. When confronting seemingly conflicting data:

  • Consider tissue-specific effects:

    • C5AR1 signaling in neutrophils during hookworm infection contributes to pathogenicity

    • In contrast, certain neurological conditions show beneficial effects of C5AR1 activation in specific neural cell populations

  • Analyze temporal dynamics:

    • Early vs. late C5AR1 activation can have opposing effects in disease progression

    • Acute activation may be protective while chronic activation becomes detrimental

  • Examine cell type-specific responses:

    • Neutrophils, the most abundant C5AR1-expressing cells in some contexts, respond differently than resident tissue macrophages

    • C5AR1 inhibition affects different glial cell populations differently, suppressing neurotoxic responses while preserving protective functions

  • Consider signaling pathway bias:

    • Different disease states may shift the balance between G protein and β-arrestin signaling

    • The three-site binding mode of C5a enables complex signaling outcomes that differ by context

  • Statistical approaches for resolving contradictions:

    • Perform meta-analyses when multiple studies show divergent results

    • Conduct dose-response experiments to identify potential biphasic effects

    • Use multivariate analysis to identify confounding variables

For example, in hookworm infection models, C5AR1 deficiency reduced lung injury and parasite burden , while in neuroinflammatory conditions, C5AR1 antagonism suppressed inflammatory responses while preserving neuroprotective functions . These seemingly contradictory outcomes likely reflect the complex role of C5AR1 in different tissue environments and disease stages.

What bioinformatic approaches are most effective for analyzing C5AR1-dependent gene expression changes?

Several bioinformatic strategies are particularly valuable for analyzing C5AR1-dependent transcriptional changes:

  • Differential expression analysis:

    • Compare C5AR1-wildtype vs. knockout/inhibited conditions to identify directly regulated genes

    • Apply multiple testing correction (e.g., Benjamini-Hochberg) to control false discovery rate

    • Use volcano plots to visualize both statistical significance and fold change magnitude

  • Pathway enrichment analysis:

    • Gene Ontology (GO) term enrichment to identify biological processes affected

    • KEGG pathway analysis to map genes to established signaling networks

    • Gene Set Enrichment Analysis (GSEA) to detect subtle but coordinated expression changes

  • Cell-type specific analysis approaches:

    • Single-cell/nucleus RNA-seq to identify cell population-specific responses

    • Deconvolution algorithms for bulk RNA-seq to estimate cell type proportions and their changes

    • Cell-type specific signature analysis to track responses in particular populations

  • Network analysis:

    • Construct protein-protein interaction networks of differentially expressed genes

    • Identify hub genes and master regulators through which C5AR1 exerts its effects

    • Apply weighted gene co-expression network analysis (WGCNA) to identify gene modules

  • Integration with epigenomic data:

    • Correlate expression changes with chromatin accessibility (ATAC-seq)

    • Identify transcription factor binding sites enriched near differentially expressed genes

For example, single-cell and single-nucleus RNA-seq analysis of hippocampi from Arctic48 mice identified specific neurotoxic disease-associated microglia clusters that are C5AR1-dependent, while also revealing that genes associated with synapse organization, transmission, and learning were overrepresented in C5AR1-antagonist treated mice . This cell-type specific approach provided insights that would be masked in bulk tissue analysis.

What are the most promising future research directions for C5AR1 in therapeutic development?

Based on current understanding of C5AR1 biology, several promising research directions emerge:

  • Development of pathway-selective modulators:

    • Biased ligands that selectively engage beneficial signaling pathways while minimizing detrimental ones

    • Structure-guided design based on the three-site binding model to create ligands with precise pharmacological profiles

    • Allosteric modulators that fine-tune receptor activity rather than completely block it

  • Tissue-targeted delivery approaches:

    • CNS-penetrant C5AR1 modulators for neuroinflammatory conditions

    • Lung-targeted delivery systems for respiratory conditions where C5AR1 plays a pathological role

    • Cell-specific targeting strategies to modulate C5AR1 in disease-relevant cell populations

  • Combination therapies:

    • C5AR1 modulation combined with other complement-targeted approaches

    • Integration with standard-of-care treatments in inflammatory conditions

    • Sequential therapy approaches targeting different disease stages

  • Biomarker development:

    • Identification of C5AR1-dependent biomarkers to stratify patients for targeted therapy

    • Development of imaging agents to monitor C5AR1 engagement in vivo

    • Surrogate endpoints that predict therapeutic efficacy

  • Expanded disease applications:

    • Beyond traditional inflammatory conditions to metabolic, neurodegenerative, and oncological applications

    • Investigation of protective roles in specific contexts

    • Exploration of C5AR1 in tissue repair and regeneration

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.