Recombinant Pongo pygmaeus Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1)

What is the functional role of UQCRFS1 in mitochondrial respiration?

UQCRFS1 (Ubiquinol-Cytochrome c Reductase, Rieske Iron-Sulfur Polypeptide 1) is a crucial catalytic core subunit of the cytochrome b-c1 complex (Complex III) in the mitochondrial electron transport chain. It contains a [2Fe-2S] iron-sulfur cluster and plays a central role in oxidative phosphorylation by catalyzing electron transfer from ubiquinol to cytochrome c. This redox reaction is linked to the translocation of protons across the mitochondrial inner membrane, with protons being carried as hydrogens on the quinol molecule. In the process known as the Q cycle, 2 protons are consumed from the mitochondrial matrix, 4 protons are released into the intermembrane space, and 2 electrons are transferred to cytochrome c . The Rieske protein cycles between two conformational states during catalysis to facilitate electron transfer from the quinol bound in the Q(0) site in cytochrome b to cytochrome c1, making it essential for cellular energy production .

How is UQCRFS1 assembled into Complex III of the respiratory chain?

The incorporation of UQCRFS1 represents the penultimate step in Complex III assembly . The process involves post-translational modifications and coordinated assembly with other subunits of the cytochrome b-c1 complex. Once incorporated into the complex III dimer, UQCRFS1 undergoes proteolytic processing, resulting in the generation of functional fragments that are essential for the complex's activity . This hierarchical assembly process ensures proper formation of the respiratory chain complex and is critical for mitochondrial function. Research in bacterial systems, which have simpler cytochrome bc1-complexes encoded by the petABC operon (consisting of the Rieske iron-sulphur protein, b-type cytochrome, and c1-type cytochrome), has provided valuable insights into the assembly mechanisms that may be partially conserved in eukaryotic systems .

What experimental approaches are commonly used to study UQCRFS1 function?

Several methodological approaches are employed to investigate UQCRFS1 function:

• Genetic manipulation: Knockdown or knockout studies using siRNA transfection or CRISPR-Cas9 editing to assess the effects of reduced UQCRFS1 expression on cellular functions .

• Protein purification: Isolation of recombinant proteins from expression systems like E. coli to obtain purified UQCRFS1 for structural and functional studies, similar to the approach used with bacterial Rieske proteins which were found to contain correctly inserted [2Fe-2S] clusters .

• Spectroscopic analysis: Electron paramagnetic resonance (EPR) spectroscopy to characterize the [2Fe-2S] cluster, showing typical signals and redox properties with midpoint potential (Em) values around +275 mV .

• Cell-based assays: Assessment of cell proliferation (using CCK8 assay), cell cycle progression and apoptosis (using flow cytometry), reactive oxygen species (ROS) production (using DCFH-DA), and expression of related genes (using RT-PCR) .

• Antibody-based detection: Western blot analysis using specific antibodies, such as mouse monoclonal or rabbit recombinant monoclonal antibodies against UQCRFS1/RISP, to detect protein expression levels in different tissues or cell lines .

How does the structure-function relationship of UQCRFS1 contribute to electron transfer mechanisms?

The UQCRFS1 protein contains a [2Fe-2S] iron-sulfur cluster coordinated by two histidine and two cysteine residues, creating a unique redox-active center. This arrangement allows the protein to cycle between two conformational states during catalysis, facilitating electron transfer between the quinol binding site (Q0) in cytochrome b and cytochrome c1 . The amino acid sequence of Pongo pygmaeus UQCRFS1 (79-274 region) includes critical domains such as "SHTDVRVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNVVTQFVS SMSASADVLALAKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDP QHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNL EVPIYEFTSDDMVIVG" . The conserved cysteine and histidine residues in this sequence are critical for coordinating the iron-sulfur cluster and maintaining its redox properties. Researchers investigating the structure-function relationship should employ site-directed mutagenesis of these conserved residues, followed by activity assays and spectroscopic analyses to elucidate how specific structural elements contribute to the protein's redox function.

What are the implications of UQCRFS1 overexpression in cancer progression, and what experimental designs best investigate this relationship?

UQCRFS1 has been reported to be highly expressed in multiple cancer types, including gastric, breast, and ovarian cancers, suggesting a potential role in cancer progression . In ovarian cancer specifically, high UQCRFS1 expression correlates with poor prognosis, as demonstrated by Kaplan-Meier analysis . Spearman correlation analysis has revealed that high UQCRFS1 expression is associated with cell cycle regulation, apoptosis, oxidative phosphorylation, and DNA damage response .

To investigate this relationship, researchers should consider the following experimental design:

• Expression profiling: Analyze UQCRFS1 expression across cancer cell lines and patient samples using RT-PCR, western blot, and immunohistochemistry, correlating expression levels with clinical outcomes.

• Functional studies: Perform UQCRFS1 knockdown experiments in cancer cell lines with high endogenous expression (as demonstrated with A2780 and OVCAR8 ovarian cancer cell lines) , followed by comprehensive phenotypic characterization:

  • Cell proliferation assessment using CCK8 assay

  • Cell cycle analysis by flow cytometry

  • Apoptosis quantification using Annexin V/PI staining

  • ROS production measurement with DCFH-DA

  • DNA damage evaluation through analysis of DNA damage response gene expression

• Mechanistic investigation: Assess the impact of UQCRFS1 manipulation on signaling pathways, particularly the AKT/mTOR pathway, using western blot analysis of phosphorylated and total protein levels .

• In vivo studies: Establish xenograft models with UQCRFS1-modulated cancer cells to evaluate tumor growth, angiogenesis, and metastatic potential.

• Therapeutic targeting: Screen for compounds that selectively inhibit UQCRFS1 function or expression, evaluating their anticancer efficacy alone or in combination with standard therapies.

How do researchers accurately measure the redox potential of UQCRFS1 and interpret variations in different experimental conditions?

Accurate measurement of the redox potential of UQCRFS1 is crucial for understanding its electron transfer capabilities. The midpoint potential (Em) values of Rieske proteins have been reported to be approximately +275 mV, as determined for bacterial homologs . To accurately measure and interpret redox potentials:

• Purification protocol: Use affinity chromatography followed by size exclusion to obtain highly purified recombinant UQCRFS1, ensuring the [2Fe-2S] cluster remains intact during purification .

• Spectroelectrochemical analysis: Employ potentiometric titrations coupled with UV-visible spectroscopy or EPR to monitor the redox state of the [2Fe-2S] cluster at different applied potentials.

• Variable experimental conditions: Systematically alter pH, temperature, ionic strength, and the presence of detergents or lipids to evaluate their effects on the redox potential. Create a comprehensive data table documenting these variations:

• Protein environment effects: Investigate how the protein's redox potential differs when isolated versus when incorporated into the full Complex III structure, using proteoliposomes or nanodiscs to mimic the native membrane environment.

• Data interpretation: Correlate changes in redox potential with structural alterations, evolutionary conservation patterns, and functional outcomes in electron transfer efficiency.

What are the optimal conditions for expressing and purifying recombinant Pongo pygmaeus UQCRFS1 protein?

Successful expression and purification of recombinant UQCRFS1 requires careful optimization of multiple parameters:

• Expression system selection: While E. coli has been successfully used for expressing soluble forms of bacterial Rieske proteins with correctly inserted [2Fe-2S] clusters , eukaryotic UQCRFS1 may benefit from expression in insect cells (Sf9 or Hi5) or yeast systems (P. pastoris) due to its mitochondrial origin and need for proper folding and cofactor insertion.

• Construct design: Express the mature form of the protein (amino acids 79-274 for Pongo pygmaeus UQCRFS1) , excluding the mitochondrial targeting sequence. Include an appropriate affinity tag (His, GST, or MBP) with a precision protease cleavage site.

• Culture conditions: Supplement growth media with iron and sulfur sources to support [2Fe-2S] cluster formation. For E. coli expression, grow cultures at lower temperatures (16-20°C) after induction to enhance proper folding.

• Extraction and purification: Use gentle detergents (e.g., DDM or LMNG) for membrane extraction if expressing the full-length protein. Perform purification under anaerobic or low-oxygen conditions to prevent oxidative damage to the iron-sulfur cluster.

• Quality control: Verify the integrity of the purified protein using:

  • SDS-PAGE for purity assessment

  • UV-visible spectroscopy to confirm the presence of the [2Fe-2S] cluster (characteristic absorption peaks at ~330 nm and ~460 nm)

  • EPR spectroscopy to verify the proper incorporation of the iron-sulfur cluster with typical [2Fe-2S] signals

  • Mass spectrometry to confirm protein identity and post-translational modifications

How can researchers accurately assess the impact of UQCRFS1 mutations on mitochondrial function?

To evaluate how mutations in UQCRFS1 affect mitochondrial function, researchers should implement a multi-parametric approach:

• Mutation selection and introduction: Identify conserved residues based on sequence alignments across species, focusing on those coordinating the [2Fe-2S] cluster or involved in conformational changes during electron transfer. Introduce these mutations using site-directed mutagenesis into recombinant expression constructs and cell lines using CRISPR-Cas9 gene editing.

• Respiratory chain complex activity assays:

  • Complex III (ubiquinol-cytochrome c oxidoreductase) activity can be measured spectrophotometrically by monitoring the reduction of cytochrome c at 550 nm

  • Oxygen consumption rates can be measured using high-resolution respirometry or Seahorse XF analyzers

  • ATP production can be quantified using luminescence-based assays

• Mitochondrial membrane potential assessment: Use fluorescent dyes like TMRM or JC-1 to evaluate changes in mitochondrial membrane potential resulting from UQCRFS1 mutations.

• ROS production measurement: Employ fluorescent probes such as DCFH-DA (used in previous UQCRFS1 studies) to quantify changes in ROS levels, as alterations in electron transfer efficiency often lead to increased ROS generation.

• Structural and biophysical characterization: Compare wild-type and mutant proteins using:

  • Circular dichroism (CD) spectroscopy to assess secondary structure changes

  • EPR spectroscopy to evaluate alterations in the [2Fe-2S] cluster environment

  • Thermal shift assays to determine protein stability differences

• In-cell validation: Create stable cell lines expressing mutant forms of UQCRFS1 and evaluate:

  • Assembly of Complex III using blue native PAGE

  • Cellular bioenergetics parameters

  • Cell viability under various metabolic stresses

  • Cell cycle progression and apoptosis rates, as UQCRFS1 has been linked to these processes

How does UQCRFS1 contribute to mitochondrial dysfunction in neurodegenerative diseases?

While the search results don't specifically address UQCRFS1 in neurodegenerative diseases, the protein's critical role in mitochondrial respiration suggests potential implications. Mitochondrial dysfunction is a hallmark of many neurodegenerative disorders, including Parkinson's disease, Alzheimer's disease, and amyotrophic lateral sclerosis. Researchers investigating this connection should:

• Expression profiling: Analyze UQCRFS1 expression and post-translational modifications in brain tissues from patients with neurodegenerative diseases compared to healthy controls.

• Functional assessment: Evaluate Complex III activity in patient-derived samples and correlate with UQCRFS1 status.

• Animal models: Develop conditional knockout or knockdown models of UQCRFS1 in neuronal populations to assess the impact on neuronal function and survival.

• Interaction studies: Investigate potential interactions between UQCRFS1 and proteins implicated in neurodegenerative diseases, such as α-synuclein, tau, or SOD1.

• Therapeutic exploration: Test whether enhancing UQCRFS1 function or expression can mitigate mitochondrial dysfunction in cellular or animal models of neurodegeneration.

The methodological approach should include both in vitro biochemical analyses and in vivo studies using appropriate disease models to establish causative relationships rather than mere correlations.

What bioinformatic approaches are most effective for studying evolutionary conservation of UQCRFS1 across species?

Phylogenetic analysis of Rieske proteins has revealed interesting evolutionary patterns, including duplicated Rieske genes with differing evolutionary origins in proteobacteria and cyanobacteria . To effectively study UQCRFS1 evolution:

This comprehensive approach provides insights into the evolutionary forces shaping UQCRFS1 structure and function, potentially revealing adaptations related to species-specific metabolic requirements or environmental conditions.

What are common technical difficulties in detecting UQCRFS1 in tissue samples, and how can researchers overcome them?

Detection of UQCRFS1 in tissue samples can present several challenges that researchers should address systematically:

• Antibody specificity issues:

  • Validate antibodies using positive and negative controls, including UQCRFS1 knockout or knockdown samples

  • Consider using well-characterized antibodies like the mouse monoclonal anti-UQCRFS1/RISP antibody conjugated to HRP (suitable for Western blot analysis of human samples) or rabbit recombinant monoclonal cytochrome b-c1 complex antibodies

  • Perform epitope mapping to ensure antibodies recognize conserved regions when working with non-human samples

• Protein extraction challenges:

  • Use specialized mitochondrial isolation protocols since UQCRFS1 is a mitochondrial protein

  • Include protease inhibitors to prevent degradation during extraction

  • Optimize detergent concentrations for efficient solubilization without disrupting the protein's native structure

• Post-translational modifications:

  • Consider that UQCRFS1 undergoes proteolytic processing once incorporated into Complex III

  • Use antibodies that recognize specific forms (precursor vs. processed) of the protein

  • Employ mass spectrometry to characterize post-translational modifications

• Low abundance in certain tissues:

  • Implement signal amplification techniques such as tyramide signal amplification for immunohistochemistry

  • Use more sensitive detection methods like digital PCR for gene expression analysis

  • Consider subcellular fractionation to enrich for mitochondrial proteins

• Tissue-specific interference:

  • Optimize blocking conditions to reduce background in different tissue types

  • Employ antigen retrieval methods specific to the tissue fixation protocol used

  • Consider using alternative detection methods in tissues with high autofluorescence or peroxidase activity

How can researchers accurately distinguish between the effects of UQCRFS1 dysfunction and other mitochondrial complex deficiencies?

Distinguishing UQCRFS1-specific effects from other mitochondrial defects requires careful experimental design:

• Specific genetic manipulation:

  • Use siRNA targeting UQCRFS1 with validated specificity, as demonstrated in ovarian cancer cell studies

  • Employ CRISPR-Cas9 to create precise gene edits affecting only UQCRFS1

  • Create rescue experiments with wild-type UQCRFS1 to confirm phenotype specificity

• Comprehensive respiratory chain analysis:

  • Measure the activities of all respiratory chain complexes (I-V) individually

  • Use blue native PAGE to assess the assembly and integrity of each complex

  • Perform respirometry with specific substrates and inhibitors to isolate the contribution of each complex

• Biochemical fingerprinting:

  • Analyze metabolite profiles using mass spectrometry to identify patterns specific to Complex III dysfunction

  • Compare with known metabolic signatures of other complex deficiencies

  • Look for accumulation of specific ubiquinol intermediates indicative of Complex III/UQCRFS1 dysfunction

• Functional complementation studies:

  • Express alternative Rieske proteins (such as the bacterial petA2 gene product that can functionally replace petA1) to determine whether they can rescue UQCRFS1 deficiency

  • This approach helps distinguish between general Complex III assembly issues and specific UQCRFS1 functional defects

• Targeted inhibitor studies:

  • Use specific inhibitors of different complexes (e.g., antimycin A for Complex III, rotenone for Complex I) to compare the resulting phenotypes with those observed in UQCRFS1 dysfunction

  • This comparison helps establish which effects are attributable to general respiratory chain disruption versus UQCRFS1-specific roles

By implementing these methodological approaches, researchers can confidently attribute observed phenotypes to UQCRFS1 dysfunction rather than general mitochondrial respiratory chain deficiencies.