Recombinant Pongo pygmaeus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Overview of MT-CO2

Pongo pygmaeus Cytochrome c Oxidase subunit 2 (MT-CO2), also known as COX2, is a protein-coding gene located in the mitochondrial inner membrane . It is a subunit of cytochrome c oxidase, a crucial enzyme complex in the mitochondrial electron transport chain that drives oxidative phosphorylation . This process is essential for generating ATP, the primary energy currency of the cell . MT-CO2 participates in the transfer of electrons from cytochrome c to oxygen, which is the final step in the electron transport chain .

Gene and Protein Information

The MT-CO2 gene provides instructions for producing a subunit of the cytochrome c oxidase enzyme complex . This complex is responsible for catalyzing the reduction of oxygen to water, utilizing electrons from cytochrome c . The MT-CO2 gene is also associated with other identifiers, including HGNC: 7421, NCBI Gene: 4513, and Ensembl: ENSG00000198712 .

Aliases for MT-CO2 Gene

  • MTCO2

External IDs for MT-CO2 Gene

  • HGNC: 7421

  • NCBI Gene: 4513

  • Ensembl: ENSG00000198712

  • UniProtKB/Swiss-Prot: P00403

Function and Activity

MT-CO2 contributes to cytochrome-c oxidase activity and is involved in mitochondrial electron transport and positive regulation of vasoconstriction . It is an integral component of respiratory chain complex IV .

Cytochrome c oxidase, which includes MT-CO2, contains three multi-subunit complexes: succinate dehydrogenase (complex II), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III), and cytochrome c oxidase (complex IV) . These complexes facilitate the transfer of electrons from NADH and succinate to molecular oxygen, creating an electrochemical gradient that drives ATP synthase .

Role in Disease

Disruptions to MT-CO2 function can lead to deleterious health effects . Diseases associated with MT-CO2 include:

  • Mitochondrial Complex IV Deficiency, Nuclear Type 1

  • Mitochondrial Complex V Deficiency, Mitochondrial Type 1

  • Mitochondrial diseases associated with neurodegeneration and intracerebral iron accumulation

  • Huntington's disease and stomach cancer

  • Leber congenital amaurosis

  • Leber hereditary optic neuropathy

  • Leigh disease

  • MELAS syndrome

  • Mitochondrial complex IV deficiency nuclear type 1

  • Mitochondrial complex V (ATP synthase) deficiency mitochondrial type 1

  • Mitochondrial metabolism disease

  • Mitochondrial Myopathy, Infantile, Transient

  • NARP syndrome

  • Premature Birth

  • Subacute Necrotizing Encephalopathy of Leigh, Infantile

  • Tetralogy of Fallot

MT-CO2 and Cancer Metabolism

MT-CO2 plays a role in cancer metabolism, particularly under metabolic stress . Glucose deprivation leads to upregulation of MT-CO2 expression, which in turn stabilizes MT-CO2 mRNA by inhibiting IGF2BP3 . Elevated MT-CO2 increases FAD levels, activating LSD1 to upregulate JUN transcription, promoting glutaminolysis for tumor cell survival . MT-CO2 is essential for oncogenic Ras-induced glutaminolysis and tumor growth, with elevated expression associated with poor prognosis in lung cancer patients . Silencing MT-CO2 inhibits tumor cell viability and proliferation, suggesting it as a potential therapeutic target for Ras-driven cancers .

Expression and Localization

MT-CO2 is located in the mitochondrial inner membrane and is widely expressed in various tissues .

Table of Tissue Expression

Tissue
Hippocampal formation
Amygdala
Basal ganglia
Midbrain
Spinal cord
Cerebral cortex
Cerebellum
Hypothalamus
Choroid plexus
Retina
Thyroid gland
Parathyroid gland
Adrenal gland
Pituitary gland
Lung
Salivary gland
Esophagus
Tongue
Stomach
Duodenum
Rectum
Small intestine
Colon
Liver
Gallbladder
Pancreas
Kidney
Urinary bladder
Testis
Epididymis
Prostate
Seminal vesicle
Vagina
Breast
Cervix
Endometrium
Fallopian tube
Ovary
Placenta
Heart muscle
Skeletal muscle
Smooth muscle
Adipose tissue
Skin
Bone marrow
Appendix
Thymus
Lymph node
Tonsil
Spleen

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MAHRAQVGLQDATSPIMEELVIFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE METIWTTLPAIILILIALPSLRILYLTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLEPGDLRLLDVDNRVVLPVEAPVRMMITSQDVLHSWTVPSLGLKTDAIPGRLN QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFAL
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme a of subunit 1 to the active site (a binuclear center comprising heme a3 and CuB) in subunit 1. This binuclear center reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what are its primary functions?

MT-CO2 (Cytochrome c oxidase subunit 2) is an essential subunit of the respiratory chain complex IV in mitochondria. It plays a critical role in cellular respiration by facilitating electron transfer during oxidative phosphorylation. Recent research has revealed that MT-CO2 has significant functions beyond its traditional role in the electron transport chain. It has been implicated in metabolic reprogramming, particularly under glucose deprivation conditions, where it helps facilitate glutaminolysis and sustains tumor cell survival. MT-CO2 can increase flavin adenosine dinucleotide (FAD) levels, which activates lysine-specific demethylase 1 (LSD1) to epigenetically upregulate JUN transcription, consequently promoting glutaminase-1 (GLS1) and glutaminolysis .

How should recombinant MT-CO2 be stored and reconstituted for experimental use?

For optimal preservation of recombinant MT-CO2 protein:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

  • Briefly centrifuge the vial before opening to ensure all content is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration, with 50% being standard) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

The protein is typically supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during storage .

How does MT-CO2 contribute to metabolic reprogramming in cancer cells under glucose deprivation?

MT-CO2 plays a pivotal role in metabolic adaptation to glucose deprivation, a common condition in the tumor microenvironment. When glucose is limited, cancer cells upregulate MT-CO2 expression through two primary mechanisms:

  • Transcriptional activation: Glucose deprivation activates Ras signaling pathways, which enhance MT-CO2 transcription.

  • Post-transcriptional stabilization: Glucose deprivation inhibits IGF2BP3 (an RNA-binding protein), which increases MT-CO2 mRNA stability.

The elevated MT-CO2 levels then enable metabolic switching from glycolysis to glutaminolysis through a pathway involving FAD, LSD1, and JUN transcription, ultimately increasing GLS1 expression and glutamine metabolism. This metabolic shift allows cancer cells to use glutamine as an alternative energy source, promoting tumor cell survival under glucose-limited conditions.

Notably, MT-CO2 appears indispensable for oncogenic Ras-induced glutaminolysis and tumor growth, making it a potential therapeutic target, particularly for Ras-driven cancers .

What experimental approaches can be used to assess MT-CO2's effect on cellular metabolism?

To investigate MT-CO2's impact on cellular metabolism, researchers can employ several complementary experimental approaches:

  • Metabolic flux analysis: Use isotope-labeled substrates (e.g., 13C-glutamine) to track metabolite flow through pathways affected by MT-CO2 expression.

  • Oxygen consumption and extracellular acidification measurements: Employ technologies like Seahorse XF analyzers to assess mitochondrial respiration and glycolytic activity in cells with varying MT-CO2 expression levels.

  • Expression modulation studies:

    • Overexpression using recombinant MT-CO2 vectors

    • Knockdown using siRNA or CRISPR-Cas9 targeting MT-CO2

    • Analysis of downstream metabolic enzyme expression (e.g., GLS1)

  • Metabolite profiling: Use mass spectrometry or NMR to quantify metabolite levels (particularly glutamine-related metabolites) in MT-CO2-modulated cells.

  • Epigenetic studies: Chromatin immunoprecipitation (ChIP) assays to assess LSD1 binding and histone modification at the JUN promoter in response to MT-CO2 manipulation .

What are the implications of MT-CO2 in Ras-driven cancer progression and treatment resistance?

MT-CO2 has emerged as a critical factor in Ras-driven cancer progression through several mechanisms:

  • Metabolic adaptation: MT-CO2 is essential for Ras-induced glutaminolysis, providing an alternative energy source when glucose is limited, thus supporting cancer cell survival in nutrient-poor microenvironments.

  • Treatment resistance: By enabling metabolic flexibility, MT-CO2 may contribute to resistance against therapies targeting glycolysis or other primary metabolic pathways. Tumors with elevated MT-CO2 can potentially switch between different metabolic programs to evade treatment effects.

  • Prognostic significance: Elevated expression of MT-CO2 correlates with poor prognosis in lung cancer patients, suggesting its potential utility as a biomarker.

  • Therapeutic targeting: MT-CO2's central role in metabolic reprogramming makes it a promising therapeutic target. Inhibiting MT-CO2 could potentially disrupt the metabolic adaptations that support cancer cell survival, particularly in Ras-driven malignancies that are often difficult to treat with conventional approaches .

What are the optimal conditions for expressing recombinant MT-CO2 in E. coli?

When expressing recombinant Pongo pygmaeus MT-CO2 in E. coli, researchers should consider the following optimization parameters:

  • Expression vector selection: Vectors with a strong T7 promoter and His-tag for purification are commonly used for MT-CO2 expression.

  • E. coli strain selection: BL21(DE3) or Rosetta strains are often preferred due to their reduced protease activity and enhanced translation of eukaryotic proteins.

  • Culture conditions:

    • Temperature: 16-25°C after induction (lower temperatures reduce inclusion body formation)

    • IPTG concentration: 0.1-0.5 mM (optimize to balance yield and solubility)

    • Growth media: Enriched media like Terrific Broth can enhance protein yield

    • Induction timing: Induce at mid-log phase (OD600 = 0.6-0.8)

  • Lysis and purification:

    • Use gentle lysis methods to preserve protein structure

    • Purify using Ni-NTA affinity chromatography under native conditions

    • Consider adding low concentrations of detergents for membrane-associated proteins like MT-CO2

  • Quality assessment:

    • Verify purity by SDS-PAGE (aim for >90% purity)

    • Confirm identity by Western blot or mass spectrometry .

How can researchers design effective interaction studies between MT-CO2 and potential binding partners?

To investigate interactions between MT-CO2 and potential binding partners, researchers should implement the following methodological approaches:

  • In vitro interaction assays:

    • Pull-down assays using His-tagged MT-CO2 as bait

    • Surface Plasmon Resonance (SPR) to determine binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic binding parameters

    • Fluorescence Resonance Energy Transfer (FRET) for proximity-based interaction detection

  • Cellular interaction studies:

    • Co-immunoprecipitation (Co-IP) of endogenous proteins

    • Proximity Ligation Assay (PLA) for visualizing protein interactions in situ

    • Bimolecular Fluorescence Complementation (BiFC) for confirming direct interactions

  • Structural studies:

    • X-ray crystallography of MT-CO2 with binding partners

    • Cryo-EM for larger complexes

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) to identify interaction interfaces

  • Functional validation:

    • Mutagenesis of predicted interaction sites followed by binding assays

    • Functional assays to assess how interactions affect MT-CO2's role in metabolism

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics to predict stability of interactions .

How should researchers quantify and analyze MT-CO2-mediated metabolic changes in experimental models?

Quantification and analysis of MT-CO2-mediated metabolic changes require a systematic approach:

  • Experimental design considerations:

    • Include appropriate controls (e.g., MT-CO2 knockdown, overexpression, and scrambled controls)

    • Perform time-course experiments to capture dynamic metabolic shifts

    • Account for cell-type specific variations in MT-CO2 effects

  • Quantitative analysis methods:

    • Isotope Ratio Mass Spectrometry (IRMS) for tracking labeled substrates

    • Liquid Chromatography-Mass Spectrometry (LC-MS) for comprehensive metabolite profiling

    • Nuclear Magnetic Resonance (NMR) spectroscopy for structural identification of metabolites

  • Data processing and statistical analysis:

    • Normalize metabolite data to cell number, protein content, or internal standards

    • Apply multivariate statistical methods (PCA, PLS-DA) to identify patterns in metabolic profiles

    • Use pathway enrichment analysis to identify significantly altered metabolic pathways

  • Integration with transcriptomic and proteomic data:

    • Correlate metabolic changes with alterations in gene and protein expression

    • Construct regulatory networks to visualize MT-CO2's impact on cellular metabolism

  • Validation strategies:

    • Confirm key findings using orthogonal techniques

    • Validate in multiple cell lines to ensure generalizability

    • Test in in vivo models when possible .

What are the common pitfalls in interpreting MT-CO2 experimental data and how can they be avoided?

Several common pitfalls can complicate the interpretation of MT-CO2 experimental data:

  • Confounding effects of mitochondrial function:

    • Pitfall: Changes attributed to MT-CO2's specific functions may actually result from general mitochondrial dysfunction.

    • Solution: Include controls that distinguish between MT-CO2-specific effects and general mitochondrial impairment, such as testing other mitochondrial proteins or using specific respiratory chain inhibitors.

  • Cell type-specific responses:

    • Pitfall: Extrapolating findings from one cell type to others without validation.

    • Solution: Validate key findings in multiple cell lines with different metabolic profiles and in relevant primary cells.

  • Nutrient availability confounding:

    • Pitfall: Failing to control for varying nutrient conditions that might impact MT-CO2 function.

    • Solution: Precisely control and document medium composition and perform experiments under defined nutrient conditions.

  • Overinterpretation of correlation data:

    • Pitfall: Assuming causation from correlation between MT-CO2 levels and observed phenotypes.

    • Solution: Perform mechanistic studies with gain and loss of function experiments to establish causal relationships.

  • Protein quality issues:

    • Pitfall: Using improperly folded or degraded recombinant MT-CO2 in functional studies.

    • Solution: Rigorously assess protein quality through multiple methods (SDS-PAGE, circular dichroism, functional assays) before experimental use .

What are the most common challenges when working with recombinant MT-CO2 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant MT-CO2:

  • Protein solubility issues:

    • Challenge: MT-CO2 may form inclusion bodies during bacterial expression.

    • Solution: Express at lower temperatures (16-20°C), reduce inducer concentration, or use solubility-enhancing fusion tags (SUMO, MBP).

  • Protein stability concerns:

    • Challenge: MT-CO2 may lose activity during storage or experimental manipulation.

    • Solution: Add stabilizing agents (glycerol, trehalose), avoid repeated freeze-thaw cycles, and use freshly reconstituted protein when possible.

  • Functional verification:

    • Challenge: Confirming that recombinant MT-CO2 retains native functionality.

    • Solution: Develop activity assays based on known MT-CO2 functions, such as electron transfer capability or binding to known interaction partners.

  • Background contamination:

    • Challenge: Endogenous MT-CO2 confounding experimental results.

    • Solution: Use MT-CO2 knockout cell lines or CRISPR-engineered cells with modified endogenous MT-CO2 for clean experimental systems.

  • Reproducibility challenges:

    • Challenge: Variable results between experiments or protein batches.

    • Solution: Standardize production protocols, perform quality control on each batch, and include internal standards in all experiments .

How can researchers effectively validate antibodies for MT-CO2 detection in various experimental applications?

Thorough antibody validation is essential for reliable MT-CO2 detection:

  • Western blot validation:

    • Test against positive controls (recombinant MT-CO2) and negative controls (MT-CO2 knockout cells)

    • Verify the antibody detects a band of the expected size (~25-26 kDa)

    • Perform peptide competition assays to confirm specificity

  • Immunohistochemistry/Immunofluorescence validation:

    • Compare staining patterns with known mitochondrial markers

    • Validate subcellular localization using fractionation followed by Western blot

    • Include MT-CO2 knockdown or knockout samples as negative controls

  • Cross-reactivity assessment:

    • Test against closely related proteins (e.g., other cytochrome c oxidase subunits)

    • Validate in multiple species if cross-species reactivity is claimed

    • Compare results from multiple antibodies targeting different MT-CO2 epitopes

  • Application-specific validation:

    • For immunoprecipitation: Verify pull-down of MT-CO2 by mass spectrometry

    • For ChIP applications: Include IgG controls and known non-target regions

    • For flow cytometry: Optimize fixation and permeabilization for mitochondrial proteins

  • Documentation and transparency:

    • Maintain detailed records of validation experiments

    • Report antibody catalog numbers, lot numbers, and dilutions used

    • Publish validation data as supplementary material in research papers .

What are the emerging research areas for MT-CO2 beyond its canonical role in mitochondrial respiration?

MT-CO2 research is expanding beyond its traditional role in the respiratory chain, with several promising directions:

  • Metabolic reprogramming in cancer: MT-CO2's role in facilitating metabolic adaptation under stress conditions makes it a promising area for cancer metabolism research. Its involvement in glutaminolysis when glucose is limited suggests potential therapeutic applications in targeting metabolic vulnerabilities of tumors .

  • Signaling pathway integration: Emerging evidence indicates MT-CO2 may function at the interface between mitochondrial activity and cellular signaling pathways, particularly through its connections to Ras signaling and epigenetic modifiers like LSD1 .

  • Evolutionary biology and comparative studies: As a mitochondrially encoded protein with varying sequences across species, MT-CO2 presents opportunities for evolutionary studies and understanding species-specific metabolic adaptations.

  • Biomarker development: The correlation between MT-CO2 expression and cancer prognosis suggests potential applications in biomarker development for disease progression and treatment response prediction .

  • Novel therapeutic target development: Given its importance in cancer cell survival under stress conditions, MT-CO2 represents a promising target for developing new therapeutic approaches, particularly for difficult-to-treat Ras-driven cancers.

Future research should focus on unraveling the complete network of MT-CO2 interactions, its tissue-specific functions, and developing targeted approaches to modulate its activity in disease states.

What methodological advances are needed to better understand MT-CO2's roles in normal physiology and disease states?

Advancing our understanding of MT-CO2 will require several methodological innovations:

  • Improved protein engineering techniques:

    • Development of site-specific labeling methods for tracking MT-CO2 in living cells

    • Creation of activity-based probes to monitor MT-CO2 function in real-time

    • Engineering of MT-CO2 variants with altered functions for mechanistic studies

  • Advanced imaging approaches:

    • Super-resolution microscopy techniques to visualize MT-CO2 within mitochondrial substructures

    • Live-cell imaging methods to track MT-CO2 dynamics during metabolic adaptation

    • Correlative light and electron microscopy to connect MT-CO2 function with mitochondrial ultrastructure

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics

    • Network analysis tools to position MT-CO2 within metabolic and signaling networks

    • Mathematical modeling of MT-CO2's contributions to cellular metabolism

  • Translational research tools:

    • Development of specific MT-CO2 inhibitors or modulators

    • Creation of animal models with tissue-specific MT-CO2 modifications

    • Clinical correlation studies connecting MT-CO2 variants with disease phenotypes

  • Single-cell technologies:

    • Single-cell metabolomics to capture cell-to-cell variation in MT-CO2-related metabolism

    • Combined single-cell transcriptomics and proteomics to identify MT-CO2 regulatory networks at the individual cell level .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.