Recombinant Pongo pygmaeus Galactoside 2-alpha-L-fucosyltransferase 2 (FUT2)

Shipped with Ice Packs
In Stock

Description

Functional Role and Mechanism

FUT2 regulates the biosynthesis of HBGAs, which serve as receptors for pathogens like norovirus and rotavirus . In humans, FUT2 polymorphisms influence susceptibility to inflammatory bowel disease (IBD), hepatocellular carcinoma (HCC), and infections . The recombinant orangutan ortholog provides a comparative model to study:

  • Evolutionary conservation of fucosylation pathways .

  • Species-specific differences in glycan binding .

  • Functional impacts of FUT2 mutations on enzyme kinetics .

Pathogen-Host Interaction Studies

Recombinant Pongo pygmaeus FUT2 is used to elucidate how HBGAs mediate microbial adhesion. For example:

  • Norovirus capsid proteins bind α(1,2)-fucosylated glycans synthesized by FUT2 .

  • Rotavirus susceptibility correlates with FUT2 activity in secretor vs. non-secretor individuals .

Disease Association Research

Studies leverage this protein to investigate:

  • IBD Pathogenesis: Non-functional FUT2 variants alter gut microbiota composition, increasing inflammation risk .

  • Cancer Biomarkers: Aberrant fucosylation linked to tumor progression (e.g., HCC) is modeled using recombinant FUT2 .

Challenges and Future Directions

  • Limitations: Recombinant FUT2 lacks post-translational modifications present in mammalian systems .

  • Opportunities: CRISPR-engineered variants could model disease-associated SNPs (e.g., rs1047781 linked to HCC) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this to us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
FUT2; Galactoside alpha-(1,2-fucosyltransferase 2; Alpha(1,2FT 2; Fucosyltransferase 2; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2; Type 1 galactoside alpha-(1,2-fucosyltransferase FUT2; Type 2 galactoside alpha-(1,2-fucosyltransferase FUT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
FUT2
Target Protein Sequence
MLVVQMPFSFPVAHFILFVFTVSTIFHIQQRLAKIQAMWELPEQIPVLASTSKALGPSQLRGIWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSTTASRIPWQNYHLNDWMEEKYRHIPGEYVRLTGYPCSWTFYHHLRHEILQEFTLHDHVREEAQKFLRGLQVNGSQPSTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSPIFVVTSNGMAWCQENIDTSHSDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLAGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of L-fucose, from guanosine diphosphate-beta-L-fucose, to the terminal galactose on both O- and N-linked glycan chains of cell surface glycoproteins and glycolipids. The resulting epitope regulates various processes, including cell-cell interactions (including host-microbe interaction), cell surface expression, and cell proliferation. It preferentially fucosylates gangliosides GA1 and GM1 in the antrum, cecum, and colon, as well as in the female reproductive organs. Fucosylated host glycoproteins or glycolipids mediate interactions with intestinal microbiota, influencing its composition. This enzyme generates a soluble precursor oligosaccharide, FuC-alpha ((1,2)Galbeta-), known as the H antigen, which is an essential substrate for the final step in the soluble ABO blood group antigen synthesis pathway.
Protein Families
Glycosyltransferase 11 family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein.

Q&A

What is Pongo pygmaeus Galactoside 2-alpha-L-fucosyltransferase 2 (FUT2)?

Pongo pygmaeus Galactoside 2-alpha-L-fucosyltransferase 2 (FUT2) is an enzyme encoded by the FUT2 gene in orangutans that catalyzes the addition of fucose to the alpha-1,2 binding of type 1 glycoprotein chains. Like other mammalian α2FTs, orangutan FUT2 belongs to a family of genes that includes FUT1 and Sec1, all contained within single exons and evolved through successive duplication events . The enzyme is responsible for generating alpha-2-fucosylated glycan structures that serve as important components of histo-blood group antigens. In mammalian systems, FUT2 determines the secretor status by controlling the expression of ABH antigens in body fluids outside of erythrocytes .

How does orangutan FUT2 compare structurally to human FUT2?

Orangutan FUT2, like human FUT2, is a type II membrane protein anchored in the Golgi apparatus with a short intracytoplasmic tail and a transmembrane domain in the N-terminal location, followed by a stem region and the catalytic domain . The catalytic domain can be subdivided into N- and C-terminal subdomains. Comparative analyses suggest that the C-terminal subdomain, presumed to be the nucleotide binding domain, shows higher conservation across species than the N-terminal subdomain, which functions as the acceptor-binding domain accommodating various acceptor substrates . While specific differences exist between human and orangutan FUT2, the general structural organization is preserved due to the functional constraints placed on these enzymes throughout primate evolution.

What is the genomic organization of FUT2 in Pongo pygmaeus?

The FUT2 gene in Pongo pygmaeus, similar to other mammals, is located in a gene cluster alongside FUT1 and Sec1 genes. The gene consists of two exons (one non-coding and one coding) separated by an intron. The coding exon contains the entire open reading frame encoding the 343 amino acid protein . The gene is located on chromosome 19 (based on synteny with the human genome, where it is found at 19q13.33). The genomic organization reflects the evolutionary history of multiple gene duplications where an ancestral duplication originated FUT1 and the ancestor of FUT2 and Sec1, followed by a second duplication that originated FUT2 and Sec1 .

How has FUT2 evolved within great apes, including Pongo pygmaeus?

Phylogenetic analyses of α2FTs across mammals reveal a complex evolutionary history involving gene duplications and gene conversion events. Within the great apes, including orangutans, FUT2 has undergone species-specific evolutionary pressures. Unlike non-primate mammals where FUT2 and Sec1 sequences often cluster by species (indicating frequent gene conversion), primate FUT2 and Sec1 genes typically cluster by gene type rather than by species . This suggests that in primates, including Pongo pygmaeus, gene conversion between FUT2 and Sec1 may be more limited, possibly due to functional differentiation and/or inactivation of Sec1 in many primate lineages. When examining sequence segments separately, evolutionary relationships become even more complex, indicating that different parts of these genes have distinct evolutionary histories due to recombination events .

What gene conversion events have been detected in orangutan FUT2 compared to other primates?

While specific gene conversion events in orangutan FUT2 are not explicitly detailed in the provided search results, the broader pattern in primates suggests limited and likely ancient gene conversion events. Unlike in some non-primate mammals where extensive gene conversion between FUT2 and Sec1 is observed, primate α2FTs show evidence of more restricted gene conversion . When analyzing different segments of the genes, researchers have detected recombination break points that create distinct evolutionary patterns across the gene sequence. In most primates, gene conversion appears limited primarily to the N-terminal domain of the protein, while the C-terminal catalytic domain shows greater conservation of ancestral characteristics. This pattern likely reflects functional constraints on the C-terminal domain, which is involved in nucleotide binding and is critical for enzymatic function .

What selective pressures have shaped FUT2 polymorphisms in orangutans?

Selective pressures on FUT2 in orangutans likely parallel those in other primates, though species-specific patterns may exist. In humans and other mammals, FUT2 polymorphisms are associated with susceptibility to various pathogens, suggesting that pathogen-driven selection has been a significant evolutionary force . The fucosylated glycans produced by FUT2 serve as attachment sites for various bacteria, viruses, and parasites. Population-specific polymorphisms that inactivate FUT2 function (creating non-secretor phenotypes) likely reflect balancing selection, where non-secretor status confers resistance to certain pathogens while potentially increasing susceptibility to others . In orangutans, given their distinct ecological niche and exposure to different pathogen communities in Southeast Asian forests, unique selective pressures may have shaped their FUT2 polymorphism patterns.

What are the substrate specificities of recombinant Pongo pygmaeus FUT2?

Recombinant Pongo pygmaeus FUT2, similar to other mammalian α2FTs, likely exhibits preferential activity toward type 1 glycan chains (Galβ3GlcNAcβ-R) compared to FUT1, which favors type 2 chains (Galβ4GlcNAcβ-R). The enzyme catalyzes the transfer of fucose from GDP-fucose (the donor substrate) to the terminal galactose residues of various acceptor substrates through an alpha-1,2 linkage . While maintaining specificity for the donor substrate (GDP-Fuc), orangutan FUT2 likely accommodates various acceptor substrates including Galβ3GlcNAcβ-R, Galβ4GlcNAcβ-R, Galβ3GalNAcα-R, Galβ3GalNAcβ-R, and Galβ4Glcβ-R, reflecting the enzyme's role in fucosylating diverse glycan structures found in secretions . These acceptor substrates represent the terminal portions of more complex glycan chains attached to glycoproteins and glycolipids in body fluids.

How does the catalytic activity of orangutan FUT2 compare with that of human FUT2?

While direct comparative studies of orangutan and human FUT2 catalytic activities are not detailed in the provided search results, inferences can be made based on structural and evolutionary data. The catalytic domain of FUT2 enzymes consists of N-terminal and C-terminal subdomains. The C-terminal subdomain, which corresponds to the nucleotide binding domain, shows greater conservation across species, suggesting similar binding affinities for the donor substrate GDP-fucose . Species-specific differences would more likely occur in the N-terminal subdomain, which functions as the acceptor-binding domain and accommodates diverse acceptor substrates. These differences could result in species-specific variations in substrate preferences and catalytic efficiencies. Experimental determination of kinetic parameters (Km, Vmax) would be necessary to quantify these differences precisely.

What is the role of FUT2 in HBGA expression in orangutans?

In orangutans, as in other mammals, FUT2 likely plays a crucial role in the expression of Histo-Blood Group Antigens (HBGAs) in secretions and on epithelial surfaces. FUT2 adds fucose to the alpha-1,2 binding of type 1 glycoprotein chains to produce H antigen in secretions, which serves as a precursor for the formation of A and B antigens through the action of A and B transferases . Individuals with functional FUT2 (secretors) express ABH antigens in body fluids and on mucosal surfaces, while those with non-functional FUT2 (non-secretors) lack these antigens in secretions. This distinction has implications for host-pathogen interactions, as many microorganisms use these glycan structures as attachment sites or receptors. The expression pattern of HBGAs in orangutan tissues likely resembles that of other great apes, with highest expression on epithelial surfaces that serve as pathogen entry points .

What are the optimal expression systems for producing recombinant orangutan FUT2?

For producing recombinant Pongo pygmaeus FUT2, researchers should consider several expression systems, each with advantages and limitations:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, simple media requirements, high expression levelsLimited post-translational modifications, protein may form inclusion bodies10-100 mg/L culture
Insect cells (Baculovirus)Eukaryotic processing, higher solubility, moderate glycosylationLonger production time, more expensive than bacterial systems5-50 mg/L culture
Mammalian cells (CHO, HEK293)Native-like glycosylation, proper foldingExpensive, lower yields, longer production time1-10 mg/L culture
Yeast (P. pastoris)High yield, some post-translational modificationsHypermannosylation of glycans50-300 mg/L culture

For functional studies, mammalian expression systems are often preferred despite lower yields, as they provide more native-like glycosylation patterns essential for accurate assessment of enzymatic activity. For structural studies requiring higher quantities of protein, insect cell or yeast systems may offer a better compromise between yield and proper folding. Regardless of the system chosen, including a purification tag (His, GST, or FLAG) facilitates downstream purification .

What purification strategies are most effective for orangutan FUT2?

Effective purification of recombinant orangutan FUT2 requires a multi-step approach:

  • Affinity Chromatography: Using tagged constructs (His-tagged or GST-tagged FUT2) allows for initial capture through nickel-NTA or glutathione-based affinity chromatography.

  • Ion Exchange Chromatography: As a secondary step, ion exchange chromatography can separate FUT2 from contaminants with different charge properties. At physiological pH, FUT2 (theoretical pI ~9.0) can be purified using cation exchange resins.

  • Size Exclusion Chromatography: A final polishing step using gel filtration separates aggregates and provides buffer exchange into the final storage buffer.

For membrane-bound full-length FUT2, detergent solubilization is necessary, typically using mild non-ionic detergents like DDM or CHAPS. Alternatively, expressing just the catalytic domain (lacking the transmembrane domain) can improve solubility. Purification should be performed at 4°C to minimize protein degradation, and protease inhibitors should be included in all buffers. Typical yields of purified recombinant FUT2 range from 0.5-5 mg per liter of culture, depending on the expression system used .

What in vitro assays are most reliable for measuring orangutan FUT2 enzymatic activity?

Several reliable assays can be used to measure the enzymatic activity of recombinant orangutan FUT2:

  • Radioactive Assay: This highly sensitive method uses GDP-[14C]fucose or GDP-[3H]fucose as donor substrate. After incubation with acceptor substrates, the radioactive product is separated from unreacted donor by chromatography or precipitation, and radioactivity is measured using scintillation counting.

  • HPLC-Based Assay: This non-radioactive approach detects either the reaction product or the released GDP using HPLC with UV or fluorescence detection. For higher sensitivity, fluorescently labeled acceptor substrates can be used.

  • Coupled Enzymatic Assay: GDP released during the reaction is coupled to pyruvate kinase and lactate dehydrogenase reactions, and NADH oxidation is monitored spectrophotometrically, providing a continuous readout.

  • Mass Spectrometry: LC-MS/MS can detect and quantify reaction products directly, providing unambiguous structural information but requiring specialized equipment.

For comparing activity across conditions or variants, standardized reaction conditions should include buffer (typically MES or Tris at pH 7.0-7.5), divalent cations (Mn2+ or Mg2+), and appropriate concentrations of donor (GDP-fucose) and acceptor substrates. Kinetic parameters (Km, Vmax) should be determined by varying substrate concentrations and analyzing the data using Michaelis-Menten or Lineweaver-Burk plots .

What FUT2 polymorphisms have been identified in orangutan populations?

While the search results don't provide specific data on FUT2 polymorphisms in orangutan populations, a research approach to identifying these would involve:

  • Genomic DNA Sampling: Collecting samples from multiple orangutan individuals across distinct geographic regions (Borneo and Sumatra) representing both Pongo pygmaeus and Pongo abelii species.

  • Sequencing Strategy: PCR amplification and sequencing of the FUT2 coding exon, which contains the entire coding region. Next-generation sequencing approaches could also be employed for population-level analyses.

  • Comparative Analysis: Comparison with known human FUT2 polymorphisms, particularly focusing on positions equivalent to human non-secretor alleles (such as positions corresponding to human se428, se385, etc.).

Based on patterns observed in other primates, orangutans likely possess both functional and non-functional FUT2 alleles, with potential population-specific frequency distributions. Polymorphisms would most likely occur in the N-terminal region of the protein, as the C-terminal region tends to be more conserved due to functional constraints on the catalytic domain . Any identified polymorphisms should be functionally characterized to determine their effect on enzyme activity.

How might orangutan FUT2 polymorphisms influence susceptibility to infectious diseases?

FUT2 polymorphisms in orangutans likely influence susceptibility to infectious diseases through mechanisms similar to those observed in humans. The FUT2 enzyme produces fucosylated glycans that serve as attachment sites or receptors for various pathogens . Consequently:

  • Viral Infections: Non-functional FUT2 alleles (non-secretor status) might provide resistance against viruses that use fucosylated glycans as attachment sites. In humans, non-secretors show resistance to certain norovirus strains, and similar patterns might exist for orangutan-specific viruses.

  • Bacterial Infections: Several bacterial pathogens, including Helicobacter pylori and certain E. coli strains, bind to fucosylated glycans . FUT2 polymorphisms could influence susceptibility to bacterial colonization of the orangutan gastrointestinal tract.

  • Parasite Interactions: Fucosylated glycans may also mediate interactions with certain parasites, making FUT2 status potentially relevant for parasite load and associated morbidity.

The specific disease associations would depend on the orangutan pathobiome and the glycan-binding specificities of orangutan-infecting pathogens. Geographic isolation of orangutan populations might have led to region-specific selective pressures and corresponding FUT2 polymorphism distributions, potentially explaining differential disease susceptibility between Bornean and Sumatran orangutan populations .

What is the relationship between orangutan FUT2 and the gut microbiome?

While direct studies on orangutan FUT2 and gut microbiome interactions are not detailed in the search results, extrapolation from human and other mammalian studies suggests that:

  • Microbiome Composition: FUT2 status likely influences the composition of the orangutan gut microbiome by providing specific glycan structures that serve as nutritional resources for certain bacterial species. Secretor status (functional FUT2) would be expected to promote the growth of bacteria capable of utilizing fucosylated glycans.

  • Symbiotic Relationships: Some beneficial gut bacteria may utilize FUT2-dependent fucosylated glycans, establishing symbiotic relationships that contribute to gut health. These relationships might be particularly important during early life and during recovery from intestinal injury.

  • Pathogen Resistance: The presence or absence of fucosylated glycans in the gut likely influences the ability of certain pathogens to colonize the orangutan gastrointestinal tract, potentially creating different susceptibility profiles between secretors and non-secretors.

  • Metabolic Implications: Differences in microbiome composition associated with FUT2 status could lead to variations in metabolite production, potentially affecting aspects of host metabolism and immunity.

Research in this area would require integrated metagenomic and metabolomic approaches to characterize the orangutan gut microbiome in relation to host FUT2 genotype. Such studies would be particularly valuable given orangutans' primarily herbivorous diet and specialized gut adaptations .

How can CRISPR-Cas9 be optimized for studying orangutan FUT2 function?

Optimizing CRISPR-Cas9 for studying orangutan FUT2 function requires careful consideration of several factors:

ParameterOptimization ApproachConsiderations
Guide RNA DesignUse algorithms that account for orangutan genome specificityTarget conserved functional domains; avoid SNP regions
Delivery MethodLentiviral vectors for primary cells; transfection for cell linesAdjust MOI based on cell type sensitivity
Off-target AnalysisPerform whole-genome sequencing after editingCompare to orangutan genome reference
Knock-in StrategyHomology-directed repair with ~800bp homology armsConsider codon optimization for expression
Phenotypic ValidationLectin binding assays; mass spectrometry of glycansConfirm altered fucosylation patterns

For in vitro studies, orangutan cell lines or primary cells can be edited to create FUT2 knockouts or to introduce specific polymorphisms. The edited cells can then be assessed for altered glycosylation patterns using lectin binding assays (using UEA-I lectin, which binds α1,2-fucosylated structures) or mass spectrometry analysis of released glycans. For functional studies, edited cells can be challenged with pathogens known to interact with fucosylated glycans to assess the impact of FUT2 modification on pathogen binding or infection rates. Additionally, gene expression analysis can reveal downstream effects of FUT2 modification on cellular physiology .

What are the challenges in developing glycan microarrays to study orangutan FUT2-dependent interactions?

Developing glycan microarrays to study orangutan FUT2-dependent interactions presents several technical challenges:

  • Glycan Synthesis Complexity: Producing well-defined orangutan-specific fucosylated glycans requires specialized chemical or chemoenzymatic synthesis capabilities. The synthesis must account for potentially unique structural features of orangutan glycans.

  • Array Surface Chemistry: Optimizing surface chemistry to properly present glycans in an accessible conformation without introducing artifacts. Different linker chemistries may be needed to assess the impact of presentation on binding.

  • Detection System Optimization: Developing detection systems sensitive enough to capture both high and low-affinity interactions, potentially requiring fluorescence-based methods with signal amplification.

  • Biological Sample Variability: When testing orangutan serum samples or microbial extracts, biological variability between individuals or isolates must be accounted for in experimental design and analysis.

  • Cross-Reactivity Assessment: Distinguishing specific binding to FUT2-dependent glycan structures from non-specific interactions or binding to related glycan structures.

A comprehensive approach would include microarrays featuring systematic variations in fucosylated structures (different chain types and positions of fucosylation) alongside appropriate controls. Validation using orthogonal methods (surface plasmon resonance, isothermal titration calorimetry) would be necessary to confirm interactions identified via microarray screening .

How can structural biology approaches advance our understanding of orangutan FUT2?

Structural biology approaches offer powerful tools for understanding orangutan FUT2 at the molecular level:

  • X-ray Crystallography: Determining the three-dimensional structure of orangutan FUT2 would reveal the precise arrangement of the catalytic domain and substrate binding sites. Crystallization would likely require expression of a soluble form lacking the transmembrane domain, potentially with strategic mutations to enhance crystallizability. Co-crystallization with donor substrate analogs (GDP or GDP-fucose) and acceptor substrates would provide insights into the catalytic mechanism.

  • Cryo-Electron Microscopy (Cryo-EM): For full-length FUT2 including the transmembrane domain, cryo-EM could provide structural information in a more native-like environment, potentially revealing how membrane association influences enzyme conformation.

  • Nuclear Magnetic Resonance (NMR): While challenging for a protein of FUT2's size (~343 amino acids), NMR could provide valuable information about protein dynamics and substrate interactions in solution.

  • Molecular Dynamics Simulations: Using structural data as input, MD simulations could model the dynamic behavior of orangutan FUT2, revealing conformational changes during catalysis and predicting the impact of species-specific amino acid substitutions.

  • Comparative Structural Analysis: Comparing orangutan FUT2 structure with human and other primate FUT2 structures would highlight evolutionarily conserved features versus species-specific adaptations, potentially correlating with differences in substrate specificity or catalytic efficiency.

These approaches would particularly benefit from examining the C-terminal catalytic domain, which contains a higher number of amino acids that are identical between FUT1 and FUT2 but different in Sec1, suggesting important functional constraints in this region .

What are the key unresolved questions regarding orangutan FUT2?

Several critical questions remain unresolved regarding Pongo pygmaeus FUT2:

  • Polymorphism Landscape: The extent and nature of FUT2 polymorphisms within and between orangutan populations (Bornean vs. Sumatran) remain largely unexplored. Understanding the frequency and functional impact of these polymorphisms would provide insights into selective pressures.

  • Secretor Status Distribution: The proportion of secretors versus non-secretors in wild orangutan populations and the ecological or evolutionary significance of this distribution pattern are unknown.

  • Species-Specific Substrate Preferences: While the general function of FUT2 is conserved across mammals, species-specific differences in substrate specificity and catalytic efficiency may exist, potentially reflecting adaptation to different pathogens or dietary glycans.

  • Developmental Regulation: How FUT2 expression is regulated during orangutan development and in different tissue types remains to be characterized, potentially revealing unique aspects of glycan evolution in this endangered great ape species.

  • Pathogen Interactions: The specific pathogen interactions mediated by orangutan FUT2-dependent fucosylated glycans and how these have shaped the evolution of the gene remain to be elucidated .

How might orangutan FUT2 research contribute to conservation efforts?

Research on orangutan FUT2 could contribute to conservation efforts through several avenues:

  • Disease Susceptibility Profiling: Understanding how FUT2 polymorphisms influence susceptibility to infectious diseases could help predict and manage disease outbreaks in wild and captive orangutan populations. This is particularly relevant as habitat fragmentation brings orangutans into closer contact with humans and domestic animals, potentially exposing them to novel pathogens.

  • Genetic Diversity Assessment: FUT2 polymorphisms could serve as markers for genetic diversity within fragmented orangutan populations, helping to guide breeding programs and reintroduction efforts that maximize genetic variability.

  • Microbiome Management: Insights into how FUT2 status influences the orangutan gut microbiome could inform dietary management in rehabilitation centers, potentially improving health outcomes for orphaned or rescued individuals prior to reintroduction.

  • One Health Approaches: Comparative studies of FUT2 across human and non-human primates could inform "One Health" approaches to managing infectious diseases at the human-wildlife interface, particularly for glycan-binding pathogens that might be transmitted between species.

  • Adaptation Potential: Understanding the genetic basis of host-pathogen interactions could help predict how orangutan populations might adapt to changing pathogen pressures in altered habitats, informing long-term conservation planning .

What emerging technologies will advance orangutan FUT2 research in the next decade?

Several emerging technologies are poised to transform research on orangutan FUT2 in the coming decade:

  • Long-Read Sequencing: Technologies like PacBio and Oxford Nanopore will enable more complete characterization of the orangutan FUT2 locus, including the genomic context and regulatory regions that might influence expression.

  • Single-Cell Glycomics: Emerging methods for single-cell analysis of glycosylation patterns will allow researchers to characterize cell-specific variations in FUT2-dependent fucosylation within orangutan tissues.

  • CRISPR-Based Screening: High-throughput CRISPR screening approaches could systematically evaluate the functional impact of FUT2 variants or identify genes that interact with FUT2 to regulate fucosylation.

  • Spatial Glycomics: Technologies that map glycan distributions within tissues while preserving spatial information will provide new insights into the tissue-specific roles of FUT2-dependent fucosylation in orangutan biology.

  • Glycan Editing in Organoids: The development of orangutan-derived organoid systems combined with precise glycan editing tools will provide physiologically relevant models for studying FUT2 function in specific tissue contexts.

  • Artificial Intelligence for Glycan Structure Prediction: Machine learning approaches will increasingly contribute to predicting glycan structures based on genomic data, potentially accelerating the characterization of orangutan-specific glycan repertoires influenced by FUT2 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.