Recombinant Pongo pygmaeus Histamine H2 receptor (HRH2)

Shipped with Ice Packs
In Stock

Description

Tissue Distribution in Pongo pygmaeus:

  • Peripheral: Gastric parietal cells, vascular smooth muscle, neutrophils .

  • Central Nervous System: Hippocampus, cerebellar dentate nucleus .

Applications in Research

Recombinant HRH2 is pivotal for:

  • Drug Development: Screening H2 receptor antagonists (e.g., cimetidine) and agonists .

  • Signal Transduction Studies: Investigating cAMP/PKA pathways in transfected cells .

  • Cancer Research: HRH2/H1R expression ratios correlate with colorectal cancer survival outcomes .

Comparative Recombinant HRH2 Proteins:

SpeciesExpression HostTagApplicationsSource
Pongo pygmaeusE. coliHis-tagSDS-PAGE, ligand binding
Homo sapiensHEK293Fc-tagCell-based assays
Mus musculusBaculovirusAvi-tagStructural studies

Key Research Findings

  • Cardiac Apoptosis: HRH2 activation in neonatal rat cardiomyocytes increases Bax expression and caspase-3 activity, promoting apoptosis .

  • Cross-Talk with H1R: HRH2 heterodimerizes with H1R, altering cAMP and IP3 signaling dynamics .

  • Therapeutic Potential: HRH2 agonists show promise in reducing inflammation-driven colorectal tumors in murine models .

Handling and Stability

  • Reconstitution: Use deionized water or PBS; add glycerol (5–50%) for long-term storage .

  • Stability: Working aliquots stable at 4°C for 1 week; avoid repeated freezing .

Future Directions

Ongoing studies focus on HRH2’s role in:

  • Neurodegeneration: Potential links to hippocampal signaling .

  • Cancer Immunotherapy: Dual targeting of H1R and HRH2 to modulate tumor microenvironments .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HRH2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Uniprot No.

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. It also appears to regulate gastrointestinal motility and intestinal secretion. A potential role in regulating cell growth and differentiation has been suggested. The activity of this receptor is mediated by G proteins, which activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Pongo pygmaeus Histamine H2 receptor (HRH2)?

Recombinant Pongo pygmaeus Histamine H2 receptor (HRH2) is a transmembrane protein derived from the Bornean orangutan (Pongo pygmaeus). It functions as a G-protein coupled receptor (GPCR) that responds to histamine signaling. This receptor is also known by several alternative names including H2R, HH2R, and Gastric receptor I . The full-length protein consists of 359 amino acids and is typically expressed using recombinant DNA technology in expression systems such as E. coli .

The receptor plays crucial roles in physiological processes similar to its human counterpart, including gastric acid secretion, immune response modulation, and synaptic transmission. For research applications, the recombinant protein is often produced with an N-terminal 10xHis-tag to facilitate purification and detection in experimental systems .

What expression systems are commonly used for producing recombinant HRH2?

Several expression systems can be employed for the production of recombinant HRH2, each with distinct advantages for different research applications:

The choice of expression system should be tailored to the specific research question, considering factors such as required protein yield, functional activity, and post-translational modifications.

What are the optimal storage conditions for recombinant HRH2 proteins?

Optimal storage conditions for maintaining the stability and activity of recombinant HRH2 proteins are crucial for experimental reproducibility. Based on manufacturer recommendations:

  • Long-term storage: Store at -20°C or -80°C for extended shelf life . The shelf life of liquid preparations is typically 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months .

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Buffer composition: For HRH2 membrane preparations, a typical storage buffer consists of 50 mM Tris-HCL (pH 7.4), 0.5 mM EDTA, 10 mM MgCl₂, and 10% sucrose . For purified recombinant proteins, Tris-based buffers with 50% glycerol are often used .

  • Critical considerations: Repeated freezing and thawing should be strictly avoided as it can significantly compromise protein integrity and functional activity . It is recommended to prepare multiple small-volume aliquots during initial receipt of the protein.

What experimental applications are suitable for recombinant HRH2?

Recombinant HRH2 can be utilized in various experimental applications in academic research settings:

  • Ligand Binding Assays: Using radioligand binding techniques to determine receptor concentration (Bmax) and binding affinity (Kd) for various histamine receptor agonists and antagonists . These can be performed using either:

    • Proximity detection methods (like FlashPlate)

    • Classical filtration methods

  • G Protein Signaling Studies: GTPγS binding assays to evaluate receptor-mediated G protein activation, particularly for Gs-coupled signaling .

  • Competition Binding Assays: To determine the affinity (Ki) of novel compounds against reference agonists and antagonists, facilitating drug discovery efforts .

  • Structural Biology Research: Purified recombinant protein can be used in crystallization trials or other structural biology applications to elucidate receptor three-dimensional structure.

  • Immunological Detection: Anti-Histamine H2 Receptor antibodies can be used in Western blot and ELISA to detect and quantify the receptor in various biological samples .

How can high-quality membrane preparations be optimized for HRH2 binding studies?

Optimizing membrane preparations containing HRH2 receptors is critical for obtaining reliable binding data. Key methodological considerations include:

  • Cell Line Selection: CHO-K1 cells are commonly used for expressing human HRH2 for membrane preparations due to their low endogenous receptor expression and robust protein production capabilities .

  • Membrane Preparation Protocol:

    • Harvest cells at optimal density

    • Homogenization in ice-cold buffer (typically 50 mM Tris-HCL (pH 7.4), 0.5 mM EDTA, 10 mM MgCl₂)

    • Differential centrifugation to isolate membrane fractions

    • Resuspension in storage buffer containing 10% sucrose as a cryoprotectant

  • Quality Control Assessment:

    • Saturation binding assays to determine receptor concentration (Bmax) and affinity (Kd)

    • Competition binding assays with reference compounds to verify pharmacological profile

    • Protein concentration determination using standard methods (BCA, Bradford)

  • Storage Conditions: Prepare aliquots at 2 μg/μL protein concentration and store at -80°C to maintain receptor integrity .

  • Assay Optimization: Buffer composition, incubation time, temperature, and membrane concentration should be optimized for each specific application to ensure optimal signal-to-noise ratio.

What are the challenges in comparing GPCR signaling between primate HRH2 homologs?

Comparing signaling properties between Pongo pygmaeus HRH2 and other primate homologs presents several methodological challenges that researchers must address:

  • Expression Level Normalization: Ensuring equivalent receptor expression levels across different species' receptors is crucial for comparative analysis. Western blotting with species-conserved epitope antibodies or quantitative binding assays can be employed to normalize receptor densities .

  • Signaling Pathway Differences: Despite high sequence homology, minor amino acid differences between species may result in altered G-protein coupling efficiency or preference. Comprehensive signaling assays (cAMP accumulation, Ca²⁺ mobilization, ERK phosphorylation) should be performed to capture these nuances.

  • Ligand Binding Pocket Variations: Subtle differences in the ligand binding pocket may affect agonist and antagonist binding affinities. Competition binding studies using a panel of structurally diverse ligands can help identify species-specific pharmacological profiles.

  • Experimental Design Considerations:

    • Use of matched cell backgrounds for heterologous expression

    • Parallel testing of receptors under identical conditions

    • Inclusion of appropriate positive and negative controls

    • Multiple readouts to assess signaling bias

  • Data Analysis Approaches: Statistical methods should account for inter-species variations, potentially employing paired analyses and multiple comparison corrections to identify significant differences.

How should researchers design experiments to study HRH2 receptor dimerization?

Investigating HRH2 receptor dimerization requires specialized experimental approaches:

  • Biochemical Approaches:

    • Cross-linking studies with membrane-impermeable reagents

    • Co-immunoprecipitation using differentially tagged receptors

    • Blue native PAGE to maintain protein-protein interactions

  • Biophysical Techniques:

    • Förster resonance energy transfer (FRET) between appropriately labeled receptors

    • Bioluminescence resonance energy transfer (BRET) using luciferase-tagged and fluorophore-tagged receptors

    • Fluorescence recovery after photobleaching (FRAP) to assess receptor mobility

  • Functional Complementation Assays:

    • Split luciferase complementation

    • Truncated or mutant receptor co-expression studies

  • Live Cell Imaging:

    • Single-molecule tracking to visualize receptor dynamics

    • Super-resolution microscopy (PALM/STORM) to overcome diffraction limit

  • Controls and Validations:

    • Negative controls using non-dimerizing membrane proteins

    • Positive controls with known dimerizing GPCRs

    • Concentration dependence studies to distinguish specific from non-specific interactions

    • Pharmacological manipulation with ligands that may enhance or disrupt dimers

What methodological approaches can address post-translational modifications of HRH2?

Post-translational modifications (PTMs) significantly impact GPCR function, including HRH2. Researchers should consider these methodological approaches:

  • Mass Spectrometry-Based Analysis:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for comprehensive PTM mapping

    • Targeted multiple reaction monitoring (MRM) for quantitative analysis of specific modifications

    • Enrichment strategies for phosphorylated, glycosylated, or ubiquitinated peptides

  • Site-Directed Mutagenesis:

    • Systematic mutation of putative modification sites (Ser, Thr, Tyr for phosphorylation; Asn for N-glycosylation)

    • Creation of phosphomimetic mutants (e.g., Ser/Thr to Asp/Glu)

    • Assessment of functional consequences using signaling assays

  • Modification-Specific Antibodies:

    • Phospho-specific antibodies for Western blotting or immunoprecipitation

    • Detection of glycosylation using lectins or glycosylation-specific antibodies

  • Expression System Considerations:

    • Comparison between E. coli (limited PTMs) and mammalian systems (full PTM capability)

    • Use of PTM inhibitors to assess functional importance

  • Functional Readouts:

    • Ligand binding before and after enzymatic removal of specific modifications

    • Signaling assays to assess impact on G-protein coupling and downstream pathways

    • Trafficking studies to determine effects on receptor localization

How can researchers overcome common challenges in HRH2 functional assays?

Functional characterization of HRH2 often encounters technical challenges that can be addressed through systematic troubleshooting:

ChallengePotential CausesRecommended Solutions
Low receptor expressionProtein toxicity, improper codon usage, degradationUse inducible expression systems, codon optimization, protease inhibitors
Poor functional activityImproper folding, missing cofactors, truncationTest different expression systems, supplement with required cofactors, verify full-length expression
High background in binding assaysNon-specific binding, inadequate washingInclude competitors for non-specific sites, optimize washing stringency, use filtration techniques
Inconsistent signaling resultsReceptor desensitization, variable expressionStandardize stimulation protocols, normalize to receptor expression levels
Low signal-to-noise ratioInsufficient receptor density, high backgroundIncrease membrane concentration, optimize buffer composition, use more sensitive detection methods

What controls should be included when characterizing novel HRH2 ligands?

Proper experimental controls are essential for rigorous characterization of novel HRH2 ligands:

  • Positive Controls:

    • Known H2 receptor agonists (histamine, dimaprit)

    • Reference H2 receptor antagonists (ranitidine, famotidine, cimetidine)

    • These establish assay functionality and provide benchmarks for comparison

  • Negative Controls:

    • Vehicle controls (solvent used to dissolve test compounds)

    • Structurally related inactive compounds

    • Non-transfected cells or membranes lacking HRH2 expression

  • Selectivity Controls:

    • Testing against related histamine receptor subtypes (H1, H3, H4)

    • Screening against a panel of unrelated GPCRs to assess specificity

  • Validation Approaches:

    • Concentration-response curves to determine potency (EC₅₀/IC₅₀)

    • Schild analysis to distinguish competitive from non-competitive antagonism

    • Binding kinetics (association/dissociation rates) compared to reference compounds

  • Data Analysis Considerations:

    • Multiple independent experiments with technical replicates

    • Appropriate curve fitting (e.g., four-parameter logistic equation)

    • Statistical comparison with reference compounds

What emerging technologies could advance HRH2 receptor research?

Several cutting-edge technologies offer promising avenues for advancing HRH2 receptor research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables structural determination of membrane proteins without crystallization

    • Can capture multiple conformational states of the receptor

    • Allows visualization of receptor-G protein complexes

  • CRISPR-Cas9 Genome Editing:

    • Generation of endogenous tagged receptors in relevant cell types

    • Creation of knockout models to study physiological roles

    • Introduction of species-specific variants to study evolutionary differences

  • Single-Cell Analysis:

    • Examination of receptor expression and signaling at single-cell resolution

    • Understanding of cellular heterogeneity in HRH2 responses

    • Correlation of receptor levels with functional outcomes

  • Computational Approaches:

    • Molecular dynamics simulations to study receptor dynamics and ligand interactions

    • AI-driven drug discovery targeting HRH2-specific binding pockets

    • Systems biology modeling of histamine signaling networks

  • Spatial Transcriptomics and Proteomics:

    • Mapping HRH2 expression patterns with subcellular resolution

    • Understanding tissue-specific receptor distribution and function

    • Correlation of receptor localization with disease states

The integration of these technologies with traditional pharmacological approaches will provide unprecedented insights into HRH2 biology and facilitate the development of more selective therapeutic agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.