Recombinant Pongo pygmaeus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pongo pygmaeus MC1R

Recombinant MC1R is a full-length, His-tagged protein (317 amino acids; UniProt ID: Q864L0) expressed in E. coli . It replicates the native receptor’s function in binding melanocyte-stimulating hormones (MSH) and adrenocorticotropic hormone (ACTH), activating cAMP-dependent signaling pathways critical for melanogenesis and UV response .

Domain Architecture

  • Transmembrane Domains: Seven α-helical regions (TM1–TM7) with a conserved DRY motif at TM3 .

  • Post-Translational Modifications:

    • N-terminal glycosylation site .

    • Palmitoylation site at the C-terminus for membrane anchoring .

  • Dimerization: Constitutively forms homodimers via disulfide bonds (C35, C267, C273, C275), essential for ligand binding and ER-to-plasma membrane trafficking .

Ligand Binding and Signaling

  • Agonists: Binds α-MSH, β-MSH, γ-MSH, and ACTH .

  • Downstream Pathways:

    • Activates adenylate cyclase → ↑ cAMP → ↑ PKA → melanin synthesis .

    • Enhances DNA repair via PTEN stabilization under UVB exposure .

Expression and Purification

  • Cloning: Full-length MC1R cDNA (1–317 aa) cloned into E. coli vectors .

  • Purification: Affinity chromatography using His-tag, followed by ion-exchange steps .

  • Validation: Confirmed via SDS-PAGE, Western blot, and functional assays (cAMP activation) .

Stability Considerations

  • Lyophilization: Maintains activity for >12 months at -80°C .

  • Avoid: Repeated freeze-thaw cycles; aliquot for single-use .

Mechanistic Studies

  • Pigmentation Regulation: Used to dissect MC1R’s role in eumelanin vs. pheomelanin synthesis .

  • Cancer Research: MC1R variants (e.g., R151C, R160W) impair PTEN interaction, increasing melanoma risk .

Therapeutic Development

  • Drug Screening: Identifies agonists/antagonists targeting MC1R for vitiligo or melanoma .

  • UV Response Models: Evaluates MC1R’s photoprotective role via PTEN/AKT signaling .

Pathogenic Mutations

  • RHC Variants: Red hair-associated mutations (e.g., R151C, D294H) reduce receptor activity and PTEN binding, correlating with poor melanoma survival .

  • Non-RHC Variants: Neutral polymorphisms (e.g., V174I) show minimal functional impact .

Population Genetics

  • Admixed Populations: MC1R diversity in Brazilian cohorts links Cys35Tyr and Ile155Thr variants to structural dysfunction .

Comparative Insights

  • Primate Homologs: Orangutan MC1R shares >95% sequence identity with human MC1R, making it a robust model for translational studies .

  • Murine Models: Mc1r-null mice exhibit pheomelanotic coats, while constitutive activation darkens pigmentation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of this product is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGAWCLEVSIPDGLFLSLGLVSLVENVLVV ATIAKNRNLHSPMYCFICCLALSDLLVSGGNVLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAIAAIWVASVLFSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA VTLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLTCSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) acts as a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. This receptor plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic structure of Pongo pygmaeus MC1R?

The melanocortin receptor 1 (MC1R) in Pongo pygmaeus, like in other mammals, is encoded by a single exon gene. The MC1R gene produces a protein that functions as a G-protein-coupled receptor involved in the regulation of melanin synthesis. In primates, including orangutans, the MC1R coding region has been sequenced and shown to vary extensively among higher primates .

The full-length MC1R protein in most mammals and birds consists of approximately 317 amino acids, though there is notable length variation observed across primate lineages . When working with recombinant Pongo pygmaeus MC1R, researchers should consider this conservation of core structure while accounting for the specific amino acid substitutions that may affect receptor function in this species.

How does Pongo pygmaeus MC1R differ from human MC1R?

Pongo pygmaeus MC1R shows several key differences from human MC1R at the sequence level. Initial comparative studies included the orangutan among a limited number of higher primates (baboon, orangutan, gorilla, common chimpanzee, and pygmy chimpanzee) sequenced for the MC1R coding region . These analyses revealed that while MC1R varies extensively among these primates, the nonsynonymous substitutions were not concentrated in particular functional domains .

Unlike humans, where MC1R shows considerable polymorphism associated with pigmentation phenotypes (especially in European populations), the pattern of variation in orangutans appears to be more consistent with purifying selection . This suggests different evolutionary pressures on MC1R in orangutans compared to humans, likely reflecting adaptations to different environmental conditions and selective pressures.

What expression systems are most effective for producing recombinant Pongo pygmaeus MC1R?

For recombinant expression of Pongo pygmaeus MC1R, researchers should consider several expression systems commonly used for G-protein-coupled receptors (GPCRs). Mammalian cell lines such as HEK293 or CHO cells often provide the most physiologically relevant post-translational modifications and membrane insertion for GPCRs, including MC1R.

When designing expression constructs, considerations should include:

  • The addition of epitope tags (such as His, FLAG, or HA) for detection and purification, preferably at the N-terminus to avoid interference with G-protein coupling at the C-terminus.

  • Codon optimization for the host expression system to maximize protein yield.

  • The inclusion of signal sequences to ensure proper membrane trafficking if the native signal sequence is insufficient in the heterologous system.

  • Temperature and induction conditions optimization to minimize aggregation of this membrane protein.

For functional studies, stable cell lines expressing orangutan MC1R may offer advantages over transient transfection, providing more consistent receptor levels for comparative analyses with human MC1R variants.

What are the recommended methods for purifying recombinant Pongo pygmaeus MC1R?

Purification of recombinant Pongo pygmaeus MC1R requires careful consideration of its membrane protein nature. A recommended protocol would include:

  • Solubilization of membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin, which preserve GPCR structure and function.

  • Affinity chromatography using tags engineered into the recombinant construct (e.g., His-tag, FLAG-tag).

  • Size exclusion chromatography to separate monomeric receptor from aggregates and to remove detergent micelles.

  • For structural studies, reconstitution into lipid nanodiscs or similar membrane mimetics may better preserve native conformation than detergent micelles alone.

The purification strategy should be optimized based on the intended downstream applications, with more stringent purity requirements for structural studies than for initial binding assays.

How do functional properties of recombinant Pongo pygmaeus MC1R compare to other primate MC1Rs?

Comparing the functional properties of recombinant Pongo pygmaeus MC1R with other primate MC1Rs requires rigorous pharmacological characterization. This comparison is particularly interesting given the evidence that MC1R has been subject to different selective pressures across primate lineages .

Functional studies should include:

  • Ligand binding assays using α-MSH and other melanocortin peptides to determine affinity constants.

  • G-protein coupling efficiency measurements through cAMP accumulation assays.

  • β-arrestin recruitment analysis to assess potential biased signaling.

  • Constitutive activity determination, which may vary between species.

Notably, when examining primate MC1R evolution, Mundy and Kelly observed numerous substitutions at amino acid residues across primate taxa, suggesting that the biochemical function of MC1R may not have been strictly conserved across primate lineages . This variation could result in functional differences in ligand specificity, signaling efficiency, or constitutive activity between orangutan and human MC1R.

What structural features of Pongo pygmaeus MC1R contribute to its binding specificity?

The structural features contributing to binding specificity in Pongo pygmaeus MC1R can be investigated through a combination of homology modeling, site-directed mutagenesis, and binding studies. Based on knowledge of MC1R in other species, key structural elements likely include:

  • The extracellular loops and N-terminus, which contribute to ligand recognition.

  • The transmembrane domains, particularly TM2, TM3, TM6, and TM7, which form the ligand-binding pocket in related GPCRs.

  • The second intracellular loop, which is necessary for protein interactions with GTP-binding proteins and where mutations affecting pigmentation phenotype have been found in other species .

Research has shown that in humans, MC1R variants can have altered ability to bind α-melanocyte-stimulating hormone (e.g., Val92Met) or to activate adenylyl cyclase via a G-protein-coupled pathway (e.g., Arg151Cys, Val60Leu, Arg142His, Arg160Trp, and Asp294His) . Comparative analysis of these regions in orangutan MC1R could reveal species-specific adaptations in receptor function.

How does the orangutan MC1R promoter region differ from other primates, and what implications does this have for expression regulation?

The promoter region of MC1R shows considerable variation upstream from the coding region in humans and likely in other primates as well . Studies by Makova et al. and Smith et al. suggested significant variation in these regulatory regions . For orangutan MC1R, researchers should investigate:

  • The sequence conservation/divergence in the immediate 5' promoter region compared to humans and other primates.

  • The presence and variation of variable number tandem repeat (VNTR) minisatellites located upstream of the MC1R coding region, which have been identified in humans .

  • The functional consequences of these promoter variations on transcription factor binding and expression levels.

Investigation of these regulatory regions requires PCR amplification and sequencing of genomic DNA from orangutan samples, followed by reporter gene assays to assess the functional impact of any identified variations. These studies would provide insights into species-specific regulation of MC1R expression that may contribute to pigmentation differences between orangutans and other primates.

What is the evolutionary history of MC1R in orangutans relative to other primates?

The evolutionary history of MC1R in orangutans can be reconstructed through comparative genomic analyses and molecular evolutionary studies. Initial work examining MC1R evolution in primates has included orangutan sequences , but more detailed analysis focusing specifically on orangutan lineages (both Pongo pygmaeus and Pongo abelii) would provide greater insight.

Key evolutionary analyses should include:

  • Calculation of the ratio of nonsynonymous to synonymous substitutions (Ka/Ks ratio) to assess selective pressures.

  • Identification of sites under positive or purifying selection using likelihood-based methods.

  • Reconstruction of ancestral sequences to identify key substitutions along the orangutan lineage.

  • Comparison with ecological and phenotypic data to correlate molecular evolution with adaptive traits.

What are the best approaches for analyzing MC1R-mediated signaling in recombinant systems?

Analyzing MC1R-mediated signaling in recombinant systems expressing Pongo pygmaeus MC1R requires multiple complementary approaches to fully characterize receptor function:

  • cAMP accumulation assays: As MC1R primarily couples to Gαs proteins to stimulate adenylyl cyclase, measuring cAMP production is essential. This can be accomplished using:

    • Radioactive assays measuring conversion of [α-³²P]ATP to [³²P]cAMP

    • ELISA-based cAMP detection kits

    • FRET-based sensors such as EPAC-based sensors or Glosensor technology

  • Calcium mobilization: Although secondary to cAMP signaling, calcium responses can be measured using:

    • Fluorescent calcium indicators like Fura-2 or Fluo-4

    • FRET-based calcium sensors

  • ERK1/2 phosphorylation: Downstream MAPK activation can be assessed via:

    • Western blotting with phospho-specific antibodies

    • In-cell western techniques for higher throughput

    • FRET-based sensors for real-time monitoring

  • β-arrestin recruitment: This can be evaluated using:

    • BRET-based assays with tagged receptor and β-arrestin

    • Translocation assays with fluorescently tagged β-arrestin

    • PathHunter assays that detect protein complementation

When comparing orangutan MC1R signaling with human variants, it's critical to use consistent expression levels across experiments, typically verified by cell surface ELISA or flow cytometry using tagged receptors or specific antibodies.

What techniques are recommended for studying MC1R polymorphisms in wild orangutan populations?

Studying MC1R polymorphisms in wild orangutan populations presents unique challenges due to sample accessibility and quality. Recommended approaches include:

  • Sample collection:

    • Non-invasive sampling using hair or fecal samples

    • Opportunistic sampling during veterinary interventions

    • Collaboration with rehabilitation centers and zoos

  • DNA extraction and quality assessment:

    • Optimization of extraction protocols for degraded samples

    • Quantification and quality assessment prior to amplification

  • MC1R amplification and sequence analysis:

    • Design of orangutan-specific primers based on reference sequences

    • Nested PCR approaches for low-quality samples

    • PCR amplification of the entire coding region in overlapping fragments

  • Polymorphism detection:

    • Direct sequencing of PCR products

    • Single-strand conformation polymorphism (SSCP) analysis for rapid screening

    • Restriction fragment length polymorphism (RFLP) analysis for known variants

    • Next-generation sequencing for high-throughput analysis

  • Data analysis:

    • Population genetic analyses to determine allele frequencies

    • Tests for selection (Tajima's D, Fu and Li's tests)

    • Correlation of genetic variation with phenotypic data where available

These approaches would parallel those used for studying MC1R variation in human populations, where both coding region and promoter polymorphisms have been extensively characterized .

How can recombinant Pongo pygmaeus MC1R be used to study melanocortin peptide binding specificity?

Recombinant Pongo pygmaeus MC1R provides an excellent system for comparative studies of melanocortin peptide binding specificity across primate lineages. Recommended methodologies include:

  • Competitive binding assays:

    • Use of radiolabeled ligands (e.g., [¹²⁵I]-NDP-MSH)

    • Competition with unlabeled ligands including α-MSH, β-MSH, ACTH, and synthetic analogs

    • Determination of IC₅₀ and Ki values for each ligand

  • Direct binding assays:

    • Saturation binding with increasing concentrations of labeled ligand

    • Scatchard analysis to determine Bmax and Kd values

  • Binding kinetics:

    • Association and dissociation rate constants determination

    • Real-time binding measurements using surface plasmon resonance

  • Structural basis of binding:

    • Alanine scanning mutagenesis of key residues

    • Chimeric receptors combining domains from orangutan and human MC1R

    • Molecular modeling and docking studies

  • Biophysical characterization:

    • Circular dichroism to assess secondary structure

    • Thermostability assays to evaluate ligand-induced stabilization

    • Hydrogen/deuterium exchange mass spectrometry to identify conformational changes

These studies would reveal whether evolutionary divergence in orangutan MC1R has resulted in altered binding preferences for melanocortin peptides, potentially reflecting species-specific adaptations in pigmentation regulation.

What in vitro models are most appropriate for functional studies of recombinant Pongo pygmaeus MC1R?

For functional studies of recombinant Pongo pygmaeus MC1R, several in vitro models provide complementary insights:

  • Heterologous expression systems:

    • HEK293 cells: Widely used for GPCR expression with efficient transfection and protein production

    • CHO cells: Alternative mammalian system with different glycosylation patterns

    • Sf9 insect cells: Useful for high-level expression, particularly for purification

  • Melanocyte models:

    • Melan-a cells (immortalized mouse melanocytes): Allow assessment of MC1R function in a relevant cellular context

    • Human melanocyte primary cultures: More physiologically relevant but challenging to transfect

    • Orangutan melanocytes (if available): Ideal but extremely rare and difficult to obtain

  • Reconstituted systems:

    • Purified receptor in liposomes or nanodiscs with purified G proteins

    • Cell membrane preparations expressing the receptor

    • Detergent-solubilized receptor for biophysical studies

  • Reporter systems:

    • Cells co-expressing orangutan MC1R with luciferase reporters driven by cAMP-responsive elements

    • FRET-based biosensors for real-time monitoring of signaling events

    • Split luciferase complementation assays for protein-protein interaction studies

Each system offers advantages for specific research questions. For comparative studies with human MC1R variants, consistent methodology across all receptor variants is crucial to obtain reliable comparative data.

How do ligand binding properties of Pongo pygmaeus MC1R compare with human MC1R variants?

The ligand binding properties of Pongo pygmaeus MC1R compared to human MC1R variants provide insights into both evolutionary conservation and species-specific adaptations of this receptor. Human MC1R is highly polymorphic, with many variants affecting ligand binding properties . For example, the Val92Met variant shows altered ability to bind α-melanocyte-stimulating hormone .

A comprehensive comparison should examine:

  • Binding affinity (Kd) for natural ligands:

    • α-MSH

    • β-MSH

    • ACTH

    • β-defensins (which have been identified as alternative MC1R ligands)

  • Binding kinetics:

    • Association rates (kon)

    • Dissociation rates (koff)

  • Competitive binding profiles:

    • Relative affinities for different melanocortin peptides

    • Species-specific differences in binding hierarchies

  • Binding selectivity across melanocortin receptor subtypes:

    • Cross-reactivity with MC2R, MC3R, MC4R, and MC5R ligands

These comparisons would reveal whether evolutionary divergence between human and orangutan MC1R has affected ligand recognition, potentially reflecting adaptations to different environmental pressures or pigmentation requirements.

What can orangutan MC1R teach us about the evolution of pigmentation across primates?

Orangutan MC1R represents an important comparative model for understanding the evolution of pigmentation across primates. The distinctive reddish coat color of orangutans makes them particularly interesting subjects for studying the relationship between MC1R variation and phenotype.

Key evolutionary insights from studying orangutan MC1R include:

  • Molecular signatures of selection:

    • Whether orangutan MC1R shows evidence of positive selection, purifying selection, or relaxed constraints compared to other primates

    • Whether selection patterns differ between Bornean (Pongo pygmaeus) and Sumatran (Pongo abelii) orangutans

  • Structure-function relationships:

    • Identification of key residues that differ between orangutans and other primates

    • Correlation of these differences with functional properties and coat color

  • Comparative genomics:

    • Analysis of variation patterns in orangutan MC1R relative to the extensive polymorphism observed in humans

    • Assessment of whether orangutan MC1R shows similar or different patterns of variation compared to other primates

  • Ecological correlations:

    • Whether MC1R variation in orangutans relates to habitat preferences or environmental factors

    • Whether their arboreal lifestyle has influenced selection pressures on pigmentation genes

In humans, MC1R variants have been associated with red hair, fair skin, poor tanning ability, and increased risk of skin cancers . The relative absence of such variation in non-human primates like orangutans, despite their reddish coloration, suggests different evolutionary mechanisms regulate similar phenotypes across primate lineages.

How does the interaction between MC1R and other pigmentation genes differ between orangutans and humans?

The interaction between MC1R and other pigmentation genes likely differs between orangutans and humans, reflecting their distinct evolutionary histories and pigmentation phenotypes. In humans, MC1R interacts with several other genes in the melanogenesis pathway:

  • OCA2/P gene:

    • In humans, OCA2 affects eye color and interacts with MC1R variants

    • Duffy et al. observed a decrease in skin pigmentation in individuals homozygous for strong MC1R alleles and the recessive eye color allele

    • The relationship between MC1R and OCA2 in orangutans is unknown but worthy of investigation

  • ASIP (Agouti Signaling Protein):

    • ASIP acts as an inverse agonist of MC1R in many mammals

    • Variation in this antagonistic relationship could contribute to species differences in pigmentation

  • POMC (Pro-opiomelanocortin):

    • This precursor produces α-MSH and other melanocortin peptides

    • Species differences in POMC processing or expression could affect MC1R signaling

  • TYR, TYRP1, and DCT:

    • These enzymes function downstream of MC1R to produce melanin

    • Differences in their activity or regulation could modify the phenotypic effects of MC1R variation

Research into these interactions would benefit from:

  • Co-expression studies of orangutan MC1R with other pigmentation genes

  • Comparative genomic analyses of these genes across primates

  • Functional studies examining signaling pathways in appropriate cell models

This research would help elucidate whether the distinctive reddish color of orangutans results from MC1R properties or from its interactions with other components of the melanogenesis pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.