Recombinant Pongo pygmaeus Muscarinic acetylcholine receptor M3 (CHRM3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks, and we will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time estimates.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRM3; Muscarinic acetylcholine receptor M3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MTLHSNSTTSPLFPNISSSWIHSPSDAGLPRGTVTHFGSYNVSRAAGNFSSPNGPTDDPL GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRANRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKANKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTADVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover.
Database Links

UniGene: Pab.2904

Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Muscarinic Acetylcholine Receptor M3 (CHRM3) and what are its key structural characteristics?

The Muscarinic Acetylcholine Receptor M3 (CHRM3) is a member of the G protein-coupled receptor (GPCR) superfamily that mediates the effects of the neurotransmitter acetylcholine. CHRM3 from Pongo pygmaeus shares significant homology with other muscarinic receptors but has unique structural features. The receptor consists of 590 amino acids and contains the characteristic seven-transmembrane domain structure typical of GPCRs . Unlike many GPCRs, muscarinic receptors including CHRM3 feature a large extracellular vestibule as part of an extended hydrophilic channel containing the orthosteric binding site, and a pronounced outward bend at the extracellular end of transmembrane helix 4 (TM4) . This bend is stabilized by a hydrogen bond network involving residues that are highly conserved among muscarinic receptors, suggesting functional importance.

How does CHRM3 signaling function at the cellular level?

CHRM3 primarily couples to Gq/11 proteins, distinguishing it from other muscarinic receptor subtypes like M2 that preferentially couple to Gi/o proteins . Upon activation by acetylcholine or other agonists, CHRM3 triggers intracellular signaling cascades that typically involve phospholipase C activation, leading to the generation of inositol trisphosphate (IP3) and diacylglycerol (DAG). This ultimately results in calcium mobilization and protein kinase C activation. In endothelial cells, CHRM3 activation has been linked to endothelial nitric oxide synthase (eNOS) activation and nitric oxide (NO) production, which plays a critical role in vascular tone regulation and blood pressure control . Recent studies have revealed that CHRM3 is localized to primary cilia in endothelial cells, where it may function in mechanosensing and signal transduction.

What are the optimal storage and handling conditions for recombinant CHRM3 protein?

For maximum stability and activity preservation, recombinant Pongo pygmaeus CHRM3 protein should be stored at -20°C for regular storage, or at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and activity . When preparing dilutions or experimental samples, maintain the protein in its storage buffer until immediately before use, and consider adding protease inhibitors if the experimental protocol allows.

How can molecular dynamics simulations enhance our understanding of ligand binding to CHRM3?

Molecular dynamics simulations offer valuable insights into the binding mechanisms and kinetics of ligands to CHRM3. Studies using all-atom classical molecular dynamics with explicitly represented lipids and water have revealed previously unknown binding pathways. For example, simulations of the bronchodilator tiotropium have shown that it binds transiently to an allosteric site en route to the orthosteric binding pocket of both M2 and M3 receptors . This transient allosteric binding may contribute to the drug's kinetic selectivity.

For researchers implementing similar approaches, the CHARMM force field has proven effective for these simulations. Ligand-binding simulations should be conducted without artificial forces to allow natural binding pathway discovery. For dissociation studies, a time-varying biasing term can be introduced to gradually force the ligand away from its crystallographic position without prespecifying a pathway or direction . This methodology can identify novel binding sites and intermediates that may not be apparent from static crystal structures, potentially informing the design of subtype-selective ligands with improved pharmacokinetic profiles.

What experimental approaches can be used to evaluate CHRM3 function in relation to vascular physiology?

Several complementary approaches can be employed to investigate CHRM3 function in vascular physiology:

Tissue-specific knockout models: Endothelial-specific CHRM3 knockout models have been instrumental in demonstrating the receptor's role in blood pressure regulation and acetylcholine-mediated vascular relaxation . These models can be generated using Cre-lox recombination with endothelial-specific promoters.

Ex vivo vascular reactivity studies: Isolated vessel preparations (e.g., wire myography or pressure myography) can assess acetylcholine-induced vasodilation in the presence or absence of CHRM3 antagonists or in tissues from knockout models. This approach allows direct measurement of CHRM3-mediated vascular responses.

Nitric oxide measurements: Since CHRM3 activation in endothelial cells leads to NO production, techniques such as DAF-FM fluorescence, Griess assay, or NO-selective electrodes can quantify NO release in response to CHRM3 agonists.

Primary cilia visualization and quantification: Given the localization of CHRM3 to primary cilia, immunofluorescence microscopy with CHRM3-specific antibodies combined with cilia markers (e.g., acetylated α-tubulin) can assess receptor expression and distribution. Cilia length measurements following CHRM3 activation provide functional readouts, as CHRM3 activation has been shown to enhance cilia length .

Experimental ApproachKey ParametersAdvantagesLimitations
Tissue-specific knockoutBlood pressure, vascular reactivityAllows in vivo assessment of physiological rolePotential developmental compensation
Vascular reactivity studiesEC50, Emax of acetylcholine responsesDirect measurement of functional responsesEx vivo system may not fully recapitulate in vivo conditions
NO measurementsConcentration, temporal dynamicsQuantitative assessment of key signaling moleculeIndirect measure of receptor function
Primary cilia visualizationLocalization, cilia length, co-localizationSpatial information on receptor distributionLimited functional information

How can genetic variations in CHRM3 be effectively analyzed in relation to cardiovascular phenotypes?

Analysis of CHRM3 genetic variations in relation to cardiovascular phenotypes requires a multifaceted approach:

SNP selection strategy: The CHRM3 gene contains over 1100 SNPs, making comprehensive analysis challenging . Focus on SNPs in regulatory regions, coding sequences, or those identified in genome-wide association studies related to cardiovascular phenotypes. Tagging SNPs can be selected to capture haplotype blocks within the gene.

Controlled dietary interventions: Salt sensitivity studies have revealed significant associations between CHRM3 variants and blood pressure responses to dietary salt manipulation . Such interventions should include strictly controlled salt intake periods (e.g., 7-day low-salt diet with 51.3 mmol sodium/day followed by 7-day high-salt diet with 307.8 mmol sodium/day) with comprehensive blood pressure monitoring throughout.

Longitudinal studies: Given the association of CHRM3 variants with long-term blood pressure progression and hypertension development, longitudinal cohort studies with extended follow-up (e.g., 14 years) provide valuable insights . Regular assessments of blood pressure parameters (systolic, diastolic, mean arterial pressure, pulse pressure) and hypertension incidence are essential.

Functional validation: For identified associations, in vitro studies assessing the functional consequences of specific variants on receptor expression, signaling, and desensitization/resensitization are crucial for establishing causality rather than mere correlation.

Statistical considerations: Beyond conventional association analyses, evaluate gene-environment interactions, particularly with dietary factors. Implement appropriate corrections for multiple testing given the large number of SNPs in CHRM3.

What approaches can be used to study the spatiotemporal dynamics of CHRM3 in primary cilia?

Studying CHRM3 dynamics in primary cilia presents unique challenges due to the small size and specialized nature of these organelles:

Live-cell imaging techniques: CHRM3 can be tagged with fluorescent proteins (preferably small tags like mNeonGreen or HaloTag) for real-time visualization in living cells. Spinning disk confocal or total internal reflection fluorescence (TIRF) microscopy offers the necessary spatial and temporal resolution to track receptor movement within cilia.

Super-resolution microscopy: Techniques such as structured illumination microscopy (SIM), stimulated emission depletion (STED), or photoactivated localization microscopy (PALM) can overcome the diffraction limit to resolve receptor distribution within the ciliary membrane at nanoscale resolution.

FRAP and photoactivation: Fluorescence recovery after photobleaching (FRAP) or photoactivation of specific regions within cilia can quantify CHRM3 mobility and exchange rates between ciliary and non-ciliary compartments.

Proximity labeling approaches: BioID or APEX2 fused to CHRM3 can identify proximal proteins within the ciliary compartment, providing insights into the receptor's interactome specifically within this organelle.

Optogenetic manipulation: Light-activated CHRM3 variants allow precise spatiotemporal control of receptor activation specifically within the ciliary compartment, enabling the study of localized signaling events.

When designing these studies, researchers should carefully consider potential artifacts from protein tagging and overexpression. Complementary approaches using antibody-based detection of endogenous receptors can validate observations from tagged constructs. Ciliary trafficking sequences should be preserved when creating fusion constructs to maintain proper receptor localization.

What are the critical considerations for successfully expressing recombinant CHRM3 in heterologous systems?

Successful heterologous expression of CHRM3 requires attention to several critical factors:

Expression system selection: Insect cell systems (e.g., Sf9) have proven effective for structural studies of CHRM3 . For functional studies, mammalian cell lines (HEK293, COS-7) provide appropriate post-translational modifications and G protein coupling. Each system has distinct advantages depending on research goals.

Post-translational modifications: When expressing CHRM3 in mammalian cells, treatment with muscarinic antagonists (e.g., 1 μM atropine for 24 hours) can increase receptor expression levels by preventing downregulation . This approach has been validated in COS-7 cells and can significantly improve yield.

Expression verification: Beyond simple protein detection, functional verification through radioligand binding assays (e.g., using [³H]-QNB) should be performed to confirm that the expressed receptor retains appropriate pharmacological properties. Both binding affinity and dissociation kinetics should be assessed.

Solubilization and purification: For structural or biochemical studies requiring purified protein, selection of appropriate detergents is critical. Mild detergents that maintain the native conformation while effectively solubilizing the receptor from membranes should be empirically determined.

How can researchers address challenges in studying CHRM3-mediated signaling specificity?

CHRM3-mediated signaling presents several challenges due to the receptor's coupling to multiple pathways and the presence of other muscarinic receptor subtypes. These challenges can be addressed through:

Pharmacological approach: The use of subtype-selective antagonists can help isolate CHRM3-specific responses. While perfect selectivity remains challenging, 4-DAMP (4-diphenylacetoxy-N-methylpiperidine) methiodide shows relative selectivity for M3 over M2 receptors. Researchers should employ concentration-response curves with multiple antagonists of differing selectivity profiles to mathematically derive subtype contributions.

Genetic approach: RNA interference or CRISPR-Cas9 gene editing to selectively reduce or eliminate CHRM3 expression provides greater specificity than pharmacological tools. Rescue experiments with wild-type or mutant CHRM3 constructs can confirm specificity and investigate structure-function relationships.

Pathway deconvolution: Since CHRM3 can couple to multiple downstream pathways, researchers should employ pathway-specific inhibitors and readouts to dissect signaling. For Gq/11 coupling, PLC inhibitors (U73122) or calcium chelators (BAPTA-AM) can block specific branches of downstream signaling.

Biased signaling analysis: CHRM3 may exhibit biased signaling, where different ligands preferentially activate distinct downstream pathways. Quantitative comparison of multiple signaling outputs (calcium mobilization, ERK phosphorylation, β-arrestin recruitment) using bias plots or operational models can reveal such ligand-specific signaling profiles.

Spatiotemporal resolution: CHRM3 signaling may differ based on subcellular localization (plasma membrane vs. primary cilia). Genetically encoded biosensors targeted to specific compartments (e.g., ciliary-targeted calcium or DAG sensors) can resolve compartmentalized signaling events.

How should researchers interpret conflicting data on CHRM3 functions across different experimental models?

When faced with conflicting data on CHRM3 functions across different experimental models, researchers should systematically evaluate several factors:

Species differences: CHRM3 sequence and function may vary between species. The Pongo pygmaeus CHRM3 shares high homology with human CHRM3 but may exhibit subtle differences in ligand binding or signaling properties. These differences should be quantified through direct comparative studies rather than assumed based on sequence similarity alone .

Cellular context variations: CHRM3 function can be dramatically influenced by the cellular environment, including the expression levels of specific G proteins, RGS proteins, and downstream effectors. Complete characterization of the expression profile of signaling components in each model system is essential for meaningful comparisons.

Methodological differences: Variations in experimental conditions (temperature, ionic composition of buffers, detection methods) can significantly impact results. Standardized protocols across research groups or detailed methodological reporting can help resolve apparent discrepancies.

Temporal dynamics: CHRM3 signaling undergoes complex temporal regulation through processes like desensitization, internalization, and recycling. Apparent contradictions may reflect measurements at different time points in this dynamic process rather than fundamental functional differences.

Receptor modifications: For recombinant systems, modifications such as epitope tags, fusion partners, or mutations can alter receptor properties. Careful validation against unmodified receptors is essential, as demonstrated in structural studies where binding properties of crystallization constructs were compared to wild-type receptors .

When analyzing conflicting findings, researchers should consider developing an integrated model that reconciles disparate observations by accounting for the specific conditions under which each result was obtained, rather than simply dismissing contradictory findings.

What statistical approaches are most appropriate for analyzing CHRM3 genetic association studies?

Analysis of CHRM3 genetic associations with phenotypes such as salt sensitivity and hypertension requires rigorous statistical approaches:

Power calculations: Given the high polymorphic nature of CHRM3 (>1100 SNPs), adequate sample sizing is critical . A priori power calculations should account for expected effect sizes, allele frequencies, and correction for multiple testing.

Multiple testing correction: Standard approaches include Bonferroni correction or false discovery rate (FDR) methods. For the highly polymorphic CHRM3 gene, FDR may be preferable to balance type I and type II errors, particularly in exploratory analyses.

Haplotype analysis: Individual SNPs in CHRM3 may have modest effects, but specific haplotypes can show stronger associations. Sliding window approaches can identify haplotypes associated with phenotypes of interest without a priori assumptions about haplotype structure.

Longitudinal data analysis: For studies examining CHRM3 variants and blood pressure progression over time, mixed-effects models can accommodate the correlation structure of repeated measurements while accounting for time-varying covariates.

Mendelian randomization: To assess potential causal relationships between CHRM3 variants and outcomes like hypertension, Mendelian randomization approaches can help distinguish causal effects from associations due to confounding.

Meta-analysis: Given the likely modest effect sizes of individual CHRM3 variants, meta-analysis across multiple cohorts can increase power. Researchers should employ both fixed-effects and random-effects models to account for potential heterogeneity across studies.

How might structural insights into CHRM3 advance the development of subtype-selective therapeutic agents?

The structural elucidation of the M3 muscarinic receptor has created significant opportunities for developing subtype-selective therapeutics:

Exploitation of allosteric binding sites: The identification of transient allosteric binding sites through molecular dynamics simulations suggests novel targeting strategies . These sites may offer greater subtype selectivity than the highly conserved orthosteric site. Researchers can design screens specifically targeting these allosteric pockets using structure-based virtual screening or fragment-based approaches.

Structure-kinetics relationships: The binding and unbinding kinetics of ligands may contribute more to subtype selectivity than equilibrium binding affinities. Time-resolved structural studies and computational approaches that predict kinetic parameters can guide the design of ligands with optimized kinetic selectivity profiles.

Biased ligand development: Structural insights into different active conformations of CHRM3 can facilitate the rational design of biased agonists that preferentially activate beneficial signaling pathways while minimizing unwanted effects. This may be particularly valuable for cardiovascular applications where nitric oxide production is desired without other Gq/11-mediated effects.

Integration with genetic data: Combining structural information with genetic association data can identify natural variants in CHRM3 that affect receptor function in cardiovascular diseases . These variants may highlight key residues or regions that could be targeted for therapeutic intervention.

Future research should focus on resolving structures of CHRM3 in complex with diverse ligands, particularly partial agonists and allosteric modulators, to develop a comprehensive understanding of structure-activity relationships. Additionally, structures of the receptor in complex with different effector proteins (G proteins, arrestins) would provide insights into the structural basis of signaling specificity.

What technological advances could enhance our understanding of CHRM3 function in primary cilia and cardiovascular regulation?

Several emerging technologies hold promise for advancing our understanding of CHRM3 in primary cilia and cardiovascular regulation:

Single-cell multi-omics: Integration of single-cell transcriptomics, proteomics, and functional assays can reveal cell-specific CHRM3 expression patterns and signaling networks in heterogeneous vascular tissues. This approach could identify previously unrecognized cell populations with distinct CHRM3 signaling characteristics.

Intravital microscopy: Advanced imaging techniques that allow visualization of CHRM3 trafficking and signaling in intact blood vessels of living animals would bridge the gap between in vitro findings and physiological relevance. Combining these approaches with genetic reporter systems for ciliary dynamics could provide unprecedented insights into CHRM3 function in vivo.

Organ-on-chip technologies: Microfluidic devices that recapitulate the complex architecture and flow dynamics of blood vessels could enable controlled studies of CHRM3 function under physiologically relevant conditions. These platforms are particularly well-suited for studying mechanosensory functions related to primary cilia.

CRISPR-based epigenome editing: Technologies for precisely modifying the epigenetic landscape at the CHRM3 locus could help understand how environmental factors regulate CHRM3 expression in different vascular beds and how these changes contribute to cardiovascular pathologies.

Spatially resolved proteomics: Emerging techniques that combine imaging with mass spectrometry could map the CHRM3 interactome specifically within primary cilia, providing insights into compartmentalized signaling networks that regulate vascular function.

These technological advances, particularly when applied in combination, have the potential to transform our understanding of how CHRM3 functions in specialized cellular compartments to regulate cardiovascular physiology and pathophysiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.