Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11) is a protein subunit of Complex I, also known as NADH:ubiquinone oxidoreductase, found in the mitochondrial respiratory chain . Complex I is essential for cellular energy production, catalyzing the transfer of electrons from NADH to ubiquinone, coupled with the translocation of protons across the inner mitochondrial membrane . NDUFA11, also referred to as Complex I-B14.7 or CI-B14.7, is considered an accessory subunit and is believed not to be directly involved in the catalytic activity of Complex I .
NDUFA11 is an integral membrane protein located in the membrane arm of Complex I and interacts with Complex III within the respiratory supercomplex . It is composed of a bundle of four transmembrane helices (TMHs) flanked by a short N-terminal helix and a C-terminal loop region . NDUFA11 is positioned at the interface between complex I and complex III and supports a critical interaction within the respiratory supercomplex . This protein is also associated with cardiolipin (CL), a phospholipid, on the matrix side of the inner mitochondrial membrane .
NDUFA11 functions as an assembly factor that aids in the incorporation of the distal component modules ND-4 and ND-5 to the membrane arm before the complex is fully assembled . It is required for stable complex assembly .
The NDUFA11 gene encodes the NDUFA11 protein. Alternate splicing results in multiple transcript variants . The Pongo pygmaeus NDUFA11 protein is a transmembrane protein that has the Uniprot number Q0MQB8 . The full length of the mature protein consists of 141 amino acids, with the sequence: APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGQLEGWEVFAKPKV .
Perturbed expression of NDUFA11, caused by faulty splicing, can result in diseases such as fatal infantile lactic acidemia, encephalocardiomyopathy, and late-onset myopathy . Mutations in the NDUFA11 gene are associated with severe mitochondrial Complex I deficiency . Pathogenic variants in NDUFA1, NDUFA10, and NDUFA11 can result in variable clinical presentations, including Leigh syndrome or Leigh-like symptoms and fatal encephalocardiomyopathy .
NDUFA11 Depletion Effects: Studies involving the depletion of NDUFA11 homologues in model organisms show a strong remodeling of the TCA cycle towards a glyoxylate cycle and upregulation of the fatty acid catabolic pathway .
Complex I Assembly: NDUFA11 is essential for the assembly and stability of Complex I. The correlation between NDUFA11 levels and Complex I recovery suggests that this subunit is required for stable complex assembly .
Supercomplex Formation: NDUFA11 is involved in maintaining complex I and its supercomplexes .
NDUFC2 and Complex I Deficiency: Research indicates that the absence of the NDUFC2 subunit leads to the stalling of Complex I assembly at the Q module formation stage . NDUFA11 is part of the ND2 module, and defects in this module can lead to variable clinical presentations .
NDUFA11 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the primary electron acceptor.
NDUFA11 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11) functions as a critical component of the mitochondrial respiratory chain protein complex I. It participates in electron transport during oxidative phosphorylation, facilitating the transfer of electrons from NADH to ubiquinone. This process is essential for cellular energy production through ATP synthesis in the mitochondria. The protein plays a structural role in maintaining the integrity of complex I, which is particularly important in tissues with high energy demands such as neurons .
Pongo pygmaeus (orangutan) NDUFA11 shares high sequence homology with human NDUFA11, reflecting evolutionary conservation of this critical mitochondrial protein. The specific differences between these orthologs remain subjects of comparative genomic research, with potential implications for understanding mitochondrial function evolution in primates. These differences may involve amino acid substitutions that affect protein stability or interaction capabilities while maintaining core functionality within the respiratory chain complex I .
Multiple expression systems are available for recombinant NDUFA11 production, each offering distinct advantages for specific research applications:
| Expression System | Product Code | Characteristics | Research Applications |
|---|---|---|---|
| Yeast | CSB-YP315983EXP1 | Post-translational modifications similar to mammalian systems | Structural studies requiring PTMs |
| E. coli | CSB-EP315983EXP1 | High yield, lacks mammalian PTMs | Functional studies, antibody production |
| E. coli (Biotinylated) | CSB-EP315983EXP1-B | Avi-tag biotinylation for detection and purification | Protein-protein interaction studies, detection assays |
| Baculovirus | CSB-BP315983EXP1 | Insect cell expression, intermediate PTMs | Complex structural studies |
| Mammalian cells | CSB-MP315983EXP1 | Native-like PTMs and folding | Studies requiring maximum physiological relevance |
The E. coli biotinylated system involves BirA catalyzing amide linkage between biotin and a specific lysine of the AviTag, providing enhanced detection capabilities for sensitive assays .
Optimal experimental designs for studying NDUFA11 expression changes in disease models should incorporate several critical elements. First, implement adequate biological replication (minimum n=5-6 per group) to account for inherent biological variation, as demonstrated in recent ischemic stroke studies. Second, include appropriate controls matched for age, sex, and genetic background to minimize confounding variables. Third, employ multiple detection methods (RT-PCR, Western blot, immunofluorescence) for cross-validation of expression changes. For in vitro studies, oxygen-glucose deprivation/reperfusion (OGD/R) models have proven effective, while in vivo studies benefit from middle cerebral artery occlusion (MCAO) models for ischemic conditions .
Statistical analyses should utilize independent sample t-tests for comparing mean values between experimental and control groups, with results expressed as mean ± standard deviation. Power calculations should be performed during design phases to ensure adequate sample sizes, although factors such as interdependencies among genes and their expression levels may limit precise calculations .
Investigating NDUFA11 protein-protein interactions within mitochondrial complex I requires specialized techniques that preserve native complex architecture while providing specific detection capabilities. Co-immunoprecipitation assays using antibodies against NDUFA11 or its known interaction partners (such as NDUFS1) can identify protein complexes under near-physiological conditions. For higher resolution analysis, proximity ligation assays can detect protein interactions with spatial resolution within intact cells or tissues. Biotinylated recombinant NDUFA11 (using AviTag-BirA technology) offers significant advantages for pull-down experiments, as the biotin-avidin interaction provides strong and specific binding for complex isolation .
For studying complex disruption in disease models, researchers should quantify the NDUFS1-NDUFA11 protein complex formation under both normal and pathological conditions (such as ischemia). Recent studies demonstrated significant decreases in NDUFS1-NDUFA11 complex formation in both OGD/R cellular models and MCAO animal models of ischemic stroke, suggesting complex I disruption as a potential mechanism of neuronal injury .
When designing toxicogenomic experiments involving NDUFA11, researchers must carefully consider several factors to ensure robust and interpretable results. First, implement broad sampling protocols to adequately capture biological and systematic variation within the data. Many early toxicogenomic experiments were compromised by insufficient sampling, often due to high costs. Second, ensure the experimental design reflects the specific research question being asked, whether it involves class discovery (identifying new patterns in data) or hypothesis testing regarding NDUFA11's role in toxicity mechanisms .
For class discovery experiments, such as identifying whether NDUFA11 expression changes group with other mitochondrial proteins following exposure to potentially nephrotoxic compounds, unbiased analytical approaches should be employed to detect unexpected but biologically meaningful patterns. Database considerations are also critical—toxicogenomic data should be stored with comprehensive metadata including experimental design details, chemical properties of compounds tested, resulting phenotypes, and genetic background information of test subjects .
NDUFA11 plays a significant role in ischemic stroke (IS) pathology through its involvement in disulfidptosis, a novel programmed cell death mechanism triggered by glucose deficiency and abnormal accumulation of cytotoxic disulfides. Recent research identified NDUFA11 as a differentially expressed disulfidptosis-related biomarker (DE-DRB) in IS. NDUFA11 expression was significantly reduced to 20.9% in the blood of IS patients compared to normal controls, with similar downregulation observed in both in vitro oxygen-glucose deprivation/reperfusion (OGD/R) and in vivo middle cerebral artery occlusion (MCAO) models .
The pathological mechanism appears to involve disruption of the NDUFS1-NDUFA11 protein complex, which is critical for respiratory chain protein complex I function in neuronal mitochondria. This disruption impairs cellular oxygen consumption and increases reactive oxygen species (ROS) levels, leading to mitochondrial dysfunction and cell death. Mitochondrial respiratory chain complex I is particularly vulnerable to ischemic conditions, and its dysfunction facilitates reverse electron transport-derived ROS production, further damaging mitochondria and exacerbating neuronal injury .
The interaction between NDUFS1 and NDUFA11 forms a critical protein complex essential for maintaining proper mitochondrial respiratory chain complex I function. In neurological disorders, particularly ischemic stroke, this interaction is significantly compromised. Experimental evidence demonstrates that the number of formed complexes between NDUFS1 and NDUFA11 decreases markedly in both in vitro and in vivo models of ischemic stroke. This reduction correlates with mitochondrial dysfunction and neuronal damage .
Complex I dysfunction resulting from disrupted NDUFS1-NDUFA11 interaction leads to several pathological consequences: impaired cellular oxygen consumption, increased ROS production through reverse electron transport, and ultimately mitochondrial damage and neuronal death. Since neurons have high energy demands, they are particularly vulnerable to complex I dysfunction. The NDUFS1-NDUFA11 interaction appears to be a specific target in disulfidptosis, a recently characterized cell death mechanism relevant to ischemic conditions where conventional inhibitors of ferroptosis, apoptosis, necroptosis, and autophagy show no protective effects .
Multiple lines of evidence support NDUFA11 as a potential biomarker for ischemic stroke (IS). Expression analysis from the GSE16561 dataset identified NDUFA11 as a differentially expressed disulfidptosis-related biomarker (DE-DRB) in IS. This finding was validated using blood samples from IS patients, where NDUFA11 expression was reduced to 20.9% compared to normal controls. The biomarker's specificity was further confirmed in experimental models, with significant downregulation observed in both oxygen-glucose deprivation/reperfusion (OGD/R) cellular models and middle cerebral artery occlusion (MCAO) animal models .
Current detection methods for NDUFA11 include:
| Detection Method | Application | Reliability | Limitations |
|---|---|---|---|
| RT-PCR | mRNA expression quantification | High sensitivity for transcript detection | Does not reflect protein levels or modifications |
| Western blot | Protein expression quantification | Good for relative protein levels | Semi-quantitative, requires quality antibodies |
| Immunofluorescence (IF) | Tissue/cellular localization | Excellent for visualization in neurons and cortical regions | Qualitative rather than quantitative |
| Machine learning models | Predictive diagnostics | Support Vector Machine (SVM) model showed optimal performance | Requires validation across diverse patient populations |
The support vector machine (SVM) model was identified as the optimal machine learning approach for predicting IS risk based on NDUFA11 expression, though further validation across diverse patient populations is necessary to establish clinical utility .
Machine learning (ML) approaches can be effectively integrated with NDUFA11 expression data to enhance disease prediction, particularly for ischemic stroke (IS). Recent research identified the Support Vector Machine (SVM) model as the optimal ML approach for IS prediction using disulfidptosis-related biomarkers including NDUFA11. To implement such approaches, researchers should first establish differential expression profiles between patient and control groups, as demonstrated in the GSE16561 dataset analysis. The accuracy of the model should then be verified using independent validation datasets, such as GSE58294, to confirm generalizability across diverse patient populations .
For effective ML implementation:
Feature selection should prioritize biologically relevant markers (e.g., NDUFA11) with strong differential expression
Model training should incorporate appropriate cross-validation to prevent overfitting
Performance metrics should include sensitivity, specificity, and area under the receiver operating characteristic curve
Integration with clinical parameters may improve predictive accuracy beyond expression data alone
Importantly, biological validation of ML-identified markers should be performed in both clinical samples and experimental models to establish mechanistic relevance, as demonstrated by the confirmation of NDUFA11 downregulation in patient blood samples, OGD/R cellular models, and MCAO animal models .
Therapeutic strategies targeting NDUFA11 or its interactions in mitochondrial diseases, particularly ischemic stroke, represent an emerging research frontier. Network pharmacological analysis has identified potential drug candidates, with metformin hydrochloride emerging as a promising target drug for NDUFA11-related pathologies. Therapeutic approaches might focus on several mechanisms: preserving NDUFS1-NDUFA11 complex formation, enhancing NDUFA11 expression, or mitigating downstream consequences of complex I dysfunction .
Potential therapeutic strategies include:
Small molecule stabilizers of the NDUFS1-NDUFA11 protein complex to maintain mitochondrial function during ischemic conditions
Gene therapy approaches to restore NDUFA11 expression in affected tissues
Mitochondrial-targeted antioxidants to counteract increased ROS production resulting from complex I dysfunction
Metabolic modulators that can bypass complex I-dependent energy production
Research should focus on validating the binding site of NDUFS1 to NDUFA11 to develop targeted interventions that prevent disulfidptosis-mediated damage to mitochondrial complex I. Additionally, combination therapies that address multiple aspects of ischemic injury may prove more effective than single-target approaches .
Cross-species comparisons of NDUFA11 can provide valuable insights into the evolutionary conservation and divergence of mitochondrial complex I function. The availability of recombinant Pongo pygmaeus (orangutan) NDUFA11 facilitates direct comparative studies with human and other primate NDUFA11 proteins. These comparisons can reveal how selective pressures have shaped mitochondrial function across evolutionary time, particularly in species with different metabolic demands and environmental adaptations .
Research approaches should include:
Sequence alignment and phylogenetic analysis to identify conserved domains and species-specific variations
Structural modeling to determine how amino acid differences might affect protein-protein interactions within complex I
Functional assays comparing activity and stability of NDUFA11 from different species
Expression pattern analyses across tissues to identify species-specific regulatory mechanisms
Such comparative studies may reveal how variations in NDUFA11 structure and function correlate with species-specific traits, such as brain metabolism differences between humans and non-human primates, or adaptations to different environmental stressors. This evolutionary perspective could potentially inform therapeutic strategies by identifying critical, highly conserved regions that might be less tolerant of manipulation versus more variable regions that might accommodate therapeutic targeting .
Working with recombinant NDUFA11 presents several technical challenges that researchers should anticipate and address. First, as a mitochondrial membrane protein component, NDUFA11 may exhibit solubility issues when expressed in isolation from other complex I components. Researchers can address this by using detergent screening to identify optimal solubilization conditions or by co-expressing interacting partners such as NDUFS1. Second, proper folding can be problematic in prokaryotic expression systems like E. coli. This can be mitigated by utilizing eukaryotic expression systems (yeast, baculovirus, or mammalian cells) that provide appropriate post-translational modifications and chaperone proteins .
For functional studies, recombinant NDUFA11 should ideally maintain its ability to interact with other complex I components. The biotinylated version (CSB-EP315983EXP1-B) offers advantages for protein-protein interaction studies through AviTag technology, where BirA catalyzes the specific attachment of biotin to the AviTag peptide, facilitating pull-down assays and other interaction studies .
Validating antibody specificity for NDUFA11 detection is critical for obtaining reliable experimental results across different applications. A comprehensive validation strategy should include multiple complementary approaches. First, perform Western blot analysis using recombinant NDUFA11 protein as a positive control, confirming the antibody detects a band of the expected molecular weight. Second, include a knockout or knockdown control (cells with NDUFA11 gene deleted or expression suppressed) to confirm absence of signal. Third, test cross-reactivity with closely related proteins from the NADH dehydrogenase family to ensure specificity .
For immunofluorescence applications, antibody validation should include colocalization with established mitochondrial markers to confirm the expected subcellular distribution pattern. Recent studies successfully used immunofluorescence to demonstrate NDUFA11 expression in neurons and cortical regions, indicating proper subcellular localization .
When working with clinical samples, researchers should verify antibody performance in the specific sample type (e.g., blood, tissue) and processing method (e.g., fresh, frozen, fixed) to ensure consistent detection. Pre-absorption controls using recombinant NDUFA11 can further confirm antibody specificity by demonstrating signal reduction or elimination .
When analyzing NDUFA11 expression changes in disease studies, several statistical considerations are paramount for generating reliable and reproducible results. First, ensure adequate sample size through proper experimental design. Recent ischemic stroke studies utilized groups of n=5-6, but optimal sample size should be determined based on expected effect size and variability. Second, employ appropriate statistical tests; independent sample t-tests are suitable for comparing mean values between two groups (e.g., disease vs. control), with results expressed as mean ± standard deviation .
Statistical significance thresholds should be clearly defined (typically p<0.05), but researchers should also report exact p-values and consider multiple testing corrections when analyzing NDUFA11 alongside other genes. When developing predictive models, such as the Support Vector Machine model for ischemic stroke prediction, proper cross-validation is essential to avoid overfitting, and model performance should be validated using independent datasets .
For correlation analyses between NDUFA11 and other proteins (e.g., the positive correlation between LRPPRC and NDUFA11 expression in ischemic stroke), researchers should report correlation coefficients (as in the study showing a correlation coefficient of 0.513) and assess the biological relevance of such relationships through protein-protein interaction analyses and functional studies .
Emerging technologies poised to advance our understanding of NDUFA11 function in mitochondrial diseases span multiple disciplines. CRISPR-Cas9 gene editing enables precise modification of NDUFA11, creating isogenic cell lines with specific mutations observed in patients or predicted functional domains. This approach allows direct comparison of wild-type and mutant NDUFA11 in identical genetic backgrounds. Cryo-electron microscopy now achieves near-atomic resolution of mitochondrial complex I, potentially revealing how NDUFA11 structural changes affect complex assembly and function in disease states .
Single-cell transcriptomics and proteomics can identify cell type-specific patterns of NDUFA11 expression and interaction networks, particularly valuable in heterogeneous tissues like brain. Advanced metabolic flux analysis using stable isotope tracers can quantify how NDUFA11 dysfunction affects specific metabolic pathways, linking molecular changes to cellular bioenergetics. These technologies, combined with existing approaches, will provide unprecedented insights into how NDUFA11 alterations contribute to mitochondrial disease pathogenesis and identify potential therapeutic interventions .
Integrated multi-omics approaches offer powerful strategies for enhancing biomarker development for NDUFA11-related pathologies, particularly ischemic stroke. By combining transcriptomics (gene expression), proteomics (protein levels), metabolomics (metabolite profiles), and clinical data, researchers can develop more robust and clinically useful biomarker panels. For NDUFA11, existing evidence from transcriptomic analysis identified it as a differentially expressed disulfidptosis-related biomarker (DE-DRB) in ischemic stroke. Integrating this with proteomic data on NDUFS1-NDUFA11 complex formation and metabolomic profiles of mitochondrial dysfunction could create a multi-parameter biomarker panel with enhanced sensitivity and specificity .
Implementation strategies should include:
Simultaneous collection of blood/tissue samples for multiple omics analyses from the same patients
Integration of data using systems biology approaches to identify molecular signatures
Machine learning algorithms (such as the Support Vector Machine model) to develop predictive models incorporating multiple biomarkers
Validation in diverse patient cohorts to ensure generalizability
Such integrated approaches could move beyond simple expression-based biomarkers to functional indicators of mitochondrial health, potentially enabling earlier diagnosis and more precise monitoring of therapeutic responses in ischemic stroke and other NDUFA11-related pathologies .
The identification of NDUFA11 as a disulfidptosis-related biomarker opens significant new avenues for therapeutic development in neurological disorders, particularly ischemic stroke. Disulfidptosis represents a distinct programmed cell death mechanism triggered by glucose deficiency and abnormal accumulation of cytotoxic disulfides that cannot be inhibited by conventional inhibitors of ferroptosis, apoptosis, necroptosis, or autophagy. This unique pathway offers an opportunity to develop targeted interventions for conditions where current therapies show limited efficacy .
Potential therapeutic implications include:
Development of specific inhibitors targeting the disulfidptosis pathway to preserve neuronal function during ischemic events
Strategies to maintain or restore NDUFS1-NDUFA11 complex formation, preserving mitochondrial complex I function
Pharmacological interventions that prevent the disruption of respiratory chain protein complexes during glucose deficiency
Metabolic modulators that protect against cytotoxic disulfide accumulation
Network pharmacological analysis has already identified metformin hydrochloride as a potential therapeutic agent targeting NDUFA11. Further research should focus on validating the binding site of NDUFS1 to NDUFA11 to develop more specific interventions that prevent disulfidptosis-mediated damage to mitochondrial complex I. This approach may yield treatments that address a previously unexplored mechanism of neuronal death in stroke and potentially other neurological disorders characterized by metabolic stress .