Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pongo pygmaeus NADH Dehydrogenase [Ubiquinone] 1 Beta Subcomplex Subunit 6 (NDUFB6)

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, also known as complex I-B17, is a protein that is an accessory subunit of the NADH dehydrogenase (ubiquinone) complex, which is located in the mitochondrial inner membrane . It is also known as Complex I, the largest of the five complexes of the electron transport chain . In humans, this protein is encoded by the NDUFB6 gene .

Gene Information

The NDUFB6 gene is located on the p arm of chromosome 9 at position 21.1 and is 19,659 base pairs long . Alternative splicing occurs at this locus, and two transcript variants encoding distinct isoforms have been identified . In mice, the Ndufb6 gene is located on Chromosome 4 .

Protein Structure

The NDUFB6 protein consists of 128 amino acids with a weight of 15.5 kDa . It is a subunit of the enzyme NADH dehydrogenase (ubiquinone), the largest of the respiratory complexes . The structure is L-shaped, featuring a long, hydrophobic transmembrane domain and a hydrophilic domain for the peripheral arm, which includes all known redox centers and the NADH binding site . The N-terminal hydrophobic domain can potentially fold into an alpha helix that spans the inner mitochondrial membrane, while the C-terminal hydrophilic domain interacts with globular subunits of Complex I . This conserved two-domain structure is critical for protein function, with the hydrophobic domain acting as an anchor for the NADH dehydrogenase (ubiquinone) complex at the inner mitochondrial membrane . The observed molecular weight is 16-20 kDa .

Function

Initially, NADH binds to Complex I and transfers two electrons to the isoalloxazine ring of the flavin mononucleotide (FMN) prosthetic arm, forming FMNH$$_2$$ . The electrons are then transferred through a series of iron-sulfur (Fe-S) clusters in the prosthetic arm and finally to coenzyme Q10 (CoQ), which is reduced to ubiquinol (CoQH$$_2$$) . The flow of electrons alters the protein's redox state, resulting in a conformational change and a pK shift of the ionizable side chain, which pumps four hydrogen ions out of the mitochondrial matrix .

Clinical Significance

Decreased expression of genes involved in oxidative phosphorylation, including NDUFB6, is associated with insulin resistance and type 2 diabetes . A polymorphism in the promoter region of the NDUFB6 gene, resulting in an adenine to guanine shift at rs629566, creates a DNA methylation site associated with a decline in NDUFB6 expression in the muscle of aging patients .

NDUFB6 single nucleotide polymorphisms (SNPs) modulate responses to exercising in patients with type 2 diabetes . The NDUFB6 SNP rs540467 modifies physical activity-mediated changes in insulin sensitivity, body composition, and liver fat estimates in type 2 diabetes .

Individuals with type 2 diabetes carrying the G/G genotype of the NDUFB6 SNP rs540467 exhibited a positive correlation between changes in M-value and physical activity levels compared to carriers of the A-allele, who showed no such association . Silencing Ndufb6 leads to reduced mitochondrial respiration in vitro .

Expression

NDUFB6 is expressed in various tissues, including the brain, heart muscle, skeletal muscle, and liver .

Tables

Table 1: NDUFB6 General Information

PropertyValue
AliasesNDUFB6, B17, CI, NADH:ubiquinone oxidoreductase subunit B6
External IDsOMIM: 603322; MGI: 2684983; HomoloGene: 1864; GeneCards: NDUFB6
Gene LocationChromosome 9p21.1 (Human)
Protein Size128 amino acids
Molecular Weight15.5 kDa (Calculated), 16-20 kDa (Observed)
Subcellular LocalizationMitochondrion inner membrane
FunctionAccessory subunit of mitochondrial respiratory chain NADH dehydrogenase (Complex I)
Associated Diseases/ConditionsInsulin resistance, Type 2 Diabetes

Table 2: Effects of NDUFB6 Silencing on Mitochondrial Function in C2C12 Myotubes

ConditionComplex I-linked RespirationCETF-linked RespirationRCRLCR
Control siRNA, Basal100%100%100%100%
Ndufb6 siRNA, Basal64%100%95%97%
Control siRNA, EPS-induced ContractionsIncreasedNot affectedNot affectedNot affected
Ndufb6 siRNA, EPS-induced ContractionsNot increasedNot affectedNot affectedNot affected

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFB6; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-128
Protein Length
Full Length of Mature Protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYQKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH
Uniprot No.

Target Background

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), believed to be non-catalytic. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone as the presumed immediate electron acceptor.

Protein Families
Complex I NDUFB6 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the fundamental role of NDUFB6 in mitochondrial function?

NDUFB6 serves as an accessory subunit of mitochondrial respiratory complex I, the largest membrane protein complex in mitochondria with a central function in aerobic energy metabolism . As part of the beta subcomplex, NDUFB6 contributes to the structural integrity of complex I and participates in the assembly process of this multisubunit enzyme. Complex I comprises more than 40 polypeptides and contains eight canonical FeS clusters, functioning as a proton-pumping NADH:ubiquinone oxidoreductase essential for the electron transport chain . The integration of subunits like NDUFB6 and insertion of cofactors into the nascent complex involves a complicated multistep process aided by assembly factors.

How should researchers store recombinant Pongo pygmaeus NDUFB6 to maintain optimal activity?

Based on storage recommendations for similar recombinant proteins from Pongo pygmaeus, NDUFB6 should be stored according to specific protocols that consider protein stability factors. For liquid formulations, storage at -20°C/-80°C generally provides a shelf life of approximately 6 months, while lyophilized forms may remain stable for up to 12 months at the same temperatures . Researchers should avoid repeated freeze-thaw cycles, as this can significantly reduce protein activity and integrity. For working solutions, aliquots may be stored at 4°C for up to one week . When preparing stocks for long-term storage, adding glycerol to a final concentration of 5-50% (typically 50%) is recommended before aliquoting and freezing .

What reconstitution protocols are recommended for lyophilized NDUFB6?

Prior to opening, vials containing lyophilized NDUFB6 should be briefly centrifuged to ensure all material is at the bottom of the container. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For optimal stability during storage after reconstitution, adding glycerol to a final concentration of 5-50% is recommended, with 50% being a common standard practice for similar proteins . The reconstituted solution should be mixed gently to avoid protein denaturation through excessive mechanical force, preferably using slow inversion rather than vortexing.

How can researchers verify the purity and integrity of recombinant NDUFB6?

Researchers should employ SDS-PAGE analysis to verify protein purity, with acceptable standards typically being >85% purity for research-grade recombinant proteins . Complementary analytical techniques include Western blotting using specific antibodies against NDUFB6 or against tags incorporated during the recombinant production process. Mass spectrometry can provide additional confirmation of protein identity and integrity. For functional validation, researchers may assess the protein's ability to incorporate into complex I assemblies using blue native PAGE or assess specific biochemical activities associated with the properly folded protein.

What expression systems are optimal for producing functional recombinant Pongo pygmaeus NDUFB6?

Baculovirus expression systems are frequently utilized for the production of functional mitochondrial proteins like NDUFB6 . This system offers advantages for expressing eukaryotic proteins that require post-translational modifications or proper folding. When designing expression constructs, researchers should consider including the full-length mature protein sequence (without mitochondrial targeting sequences if applicable) to ensure proper folding and function . The choice of affinity tags and their position (N- or C-terminal) should be carefully considered, as they may affect protein folding, function, or complex assembly. Purification strategies typically involve immobilized metal affinity chromatography followed by size exclusion chromatography to separate monomeric from aggregated forms.

How does Pongo pygmaeus NDUFB6 structurally and functionally compare to human NDUFB6?

Comparative structural analysis between Pongo pygmaeus and human NDUFB6 proteins reveals high sequence homology, reflecting their evolutionary closeness. These similarities make the orangutan protein valuable for comparative studies and as a model for human mitochondrial research . The functional domains, key binding regions, and post-translational modification sites are largely conserved between the species. Researchers investigating interactions within complex I should note that while core functional properties are preserved, subtle species-specific differences may exist in binding affinities with other subunits or assembly factors. These differences may be particularly relevant when using the protein in reconstitution experiments or when studying species-specific adaptations in mitochondrial energy metabolism.

What methodologies are most effective for studying NDUFB6 incorporation into complex I assembly intermediates?

To study NDUFB6 incorporation into complex I, researchers should employ a combination of blue native PAGE, immunoprecipitation, and proteomic approaches. Based on studies of related complex I subunits, chromosomal deletion or mutation of key residues can be used to analyze assembly intermediates that accumulate when specific steps are blocked . Spectroscopic techniques like EPR can be utilized to characterize the FeS cluster environment in assembly intermediates versus fully assembled complex I . Researchers should design experiments that can distinguish between direct effects on NDUFB6 incorporation versus indirect effects on other assembly steps. For instance, studies on the NUMM subunit (NDUFS6 in humans) demonstrated that its absence blocked a late step of complex I assembly, leading to accumulation of an intermediate lacking accessory subunit N7BM but containing the assembly factor N7BML instead .

How can researchers effectively investigate interactions between NDUFB6 and other complex I subunits?

Investigating protein-protein interactions within complex I requires specialized approaches due to the complex's membrane-embedded nature. Cross-linking combined with mass spectrometry represents a powerful method to map interaction interfaces between NDUFB6 and neighboring subunits. Researchers should consider employing proximity labeling techniques such as BioID or APEX to identify proteins in close spatial proximity to NDUFB6 in the native cellular environment. Yeast two-hybrid or mammalian two-hybrid systems may be useful for confirming direct interactions with specific partner proteins, particularly with soluble domains. For structural studies, cryo-electron microscopy of intact complex I or subcomplexes containing NDUFB6 provides valuable insights into the spatial arrangement and interaction surfaces of this subunit within the larger complex.

What experimental approaches are recommended for studying the role of NDUFB6 in mitochondrial dysfunction models?

When investigating NDUFB6's role in mitochondrial dysfunction, researchers should implement complementary cellular and biochemical approaches. RNA interference or CRISPR-Cas9-mediated knockout/knockdown systems can be employed to reduce NDUFB6 levels, followed by comprehensive assessment of complex I assembly and activity. Oxygen consumption measurements using platforms like Seahorse XF analyzers provide functional readouts of mitochondrial respiration in intact cells under various conditions. Researchers should measure complex I-specific activities using isolated mitochondria or submitochondrial particles, assessing NADH:ubiquinone oxidoreductase activity with specific substrates and inhibitors. Complementary assessments should include reactive oxygen species production, mitochondrial membrane potential, and ATP synthesis rates to comprehensively characterize the consequences of NDUFB6 dysfunction.

How can researchers effectively compare NDUFB6 from different primate species to understand evolutionary conservation and adaptation?

Comparative analysis across primate species requires careful consideration of experimental design. Researchers should first perform detailed sequence alignments and phylogenetic analyses to identify conserved domains and species-specific variations in NDUFB6. Multiple sequence alignments should include NDUFB6 from diverse primates including Pongo pygmaeus, Pongo abelii (Sumatran orangutan), Pan troglodytes (chimpanzee), Gorilla gorilla gorilla, and humans . Recombinant expression of NDUFB6 from different species under identical conditions allows direct comparison of biochemical properties, stability, and functional characteristics. When conducting complementation experiments in cell lines, researchers should ensure the genetic background is consistent across experiments to avoid confounding variables when expressing NDUFB6 from different species.

What specialized techniques are required to analyze potential post-translational modifications of NDUFB6?

Analysis of post-translational modifications (PTMs) on NDUFB6 requires sophisticated proteomic approaches. Researchers should employ enrichment strategies specific to the PTM of interest (e.g., phosphopeptide enrichment using titanium dioxide, enrichment of ubiquitinated peptides, etc.) prior to mass spectrometry analysis. High-resolution mass spectrometry combined with electron transfer dissociation or higher-energy collisional dissociation fragmentation methods provides detailed characterization of modification sites. Site-directed mutagenesis of identified modification sites followed by functional assays establishes the physiological relevance of specific PTMs. For temporal dynamics of modifications, pulse-chase experiments combined with immunoprecipitation and PTM-specific detection methods can reveal regulation patterns under different physiological or stress conditions.

How can NDUFB6 research contribute to understanding mitochondrial disease mechanisms?

Research on NDUFB6 provides valuable insights into mitochondrial disease mechanisms, particularly those involving complex I dysfunction. Numerous human diseases are linked with complex I dysfunction or assembly defects , making NDUFB6 a potential contributor to pathological processes. Researchers should develop cellular models expressing disease-associated NDUFB6 variants to characterize their effects on complex I assembly, stability, and function. Comparative studies between wild-type and mutant forms can reveal mechanisms of pathogenicity and identify potential compensatory pathways. Integration of findings from NDUFB6 research with clinical data from patients with mitochondrial disorders helps establish genotype-phenotype correlations and may reveal novel therapeutic targets for mitochondrial diseases characterized by complex I deficiency.

What methodological approaches are recommended when utilizing NDUFB6 as a model protein for studying complex I biogenesis?

When using NDUFB6 as a model protein for complex I biogenesis studies, researchers should implement pulse-chase experiments to track the incorporation kinetics of newly synthesized NDUFB6 into complex I assembly intermediates. Fluorescent protein tagging combined with live-cell imaging provides insights into the spatiotemporal aspects of incorporation, though careful validation is necessary to ensure tags don't interfere with assembly. Inducible expression systems allow controlled timing of NDUFB6 production, facilitating the study of rate-limiting steps in complex I assembly. Researchers should compare findings from NDUFB6 with other complex I subunits, such as the NUMM subunit (NDUFS6 in humans), which has been shown to be required for insertion or stabilization of FeS cluster N4 , to develop comprehensive models of complex I biogenesis.

What are the most common technical challenges when working with recombinant NDUFB6 and how can they be addressed?

Researchers frequently encounter challenges with protein solubility and stability when working with hydrophobic mitochondrial membrane proteins like NDUFB6. To address solubility issues, optimization of detergent types and concentrations is crucial during extraction and purification steps. Mild detergents like digitonin or n-dodecyl-β-D-maltoside are often suitable for maintaining native-like structure. Protein aggregation can be minimized by maintaining appropriate ionic strength and pH throughout purification and storage protocols. The choice of buffer components significantly impacts stability, with glycerol (5-50%) and reducing agents helping maintain protein integrity . For challenging purifications, consideration of fusion partners that enhance solubility or directed evolution approaches to engineer more stable variants may be beneficial for specific research applications.

How can structural studies of NDUFB6 be optimized to yield high-resolution data?

Obtaining high-resolution structural data for membrane proteins like NDUFB6 remains challenging. Researchers should explore multiple approaches, including X-ray crystallography of the isolated protein in detergent micelles or lipidic cubic phases, and cryo-electron microscopy of the protein within the intact complex I. For crystallography, systematic screening of crystallization conditions with various detergents, lipids, and additives is essential. Conformational stabilization through antibody fragments or nanobodies can facilitate crystal formation. For cryo-EM studies, optimization of sample vitrification conditions, data collection parameters, and image processing workflows is crucial for achieving near-atomic resolution. Complementary structural techniques like nuclear magnetic resonance spectroscopy of isotopically labeled proteins can provide dynamic information not easily obtained from static structures.

What are the key considerations for designing experiments to study NDUFB6's role in zinc binding and FeS cluster stability within complex I?

The study of zinc binding and its relationship to FeS cluster stability in complex I requires carefully designed experiments that build upon findings from related subunits like NUMM (NDUFS6 in humans). X-ray crystallography combined with quantum chemical modeling has been successfully used to resolve Zn-binding sites in complex I . Researchers should employ metal content determination after chromatographic purification to quantify zinc and iron content in wild-type versus mutant complexes. Site-directed mutagenesis of potential Zn-binding residues, followed by functional and spectroscopic analysis, can establish causal relationships between zinc binding and complex I function. EPR spectroscopic analysis provides valuable information about the electronic environment of FeS clusters and can reveal how perturbations in one metal-binding site affect the properties of nearby clusters .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.