Recombinant Pongo pygmaeus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Classification

The Pongo pygmaeus MT-ND3 protein is identified in the UniProt database under the accession number Q9T9X5, while its Pongo abelii counterpart is designated as P92697 . This classification facilitates standardized research protocols and cross-referencing across scientific investigations. As a component of mitochondrial complex I, MT-ND3 belongs to the NADH dehydrogenase family of proteins that are critical for mitochondrial oxidative phosphorylation.

Recombinant Production Methods

The recombinant form of Pongo pygmaeus MT-ND3 is typically produced using Escherichia coli expression systems, allowing for controlled synthesis and purification of the protein for research applications . This recombinant production approach enables the generation of sufficient quantities of the protein with consistent quality parameters for experimental use.

Various tagging strategies may be employed during the recombinant production process, including His-tagging, which facilitates purification and detection of the protein . The expression region typically encompasses the full-length protein (amino acids 1-115), though specific applications may utilize partial sequences depending on research requirements .

Function in Respiratory Chain Complex I

MT-ND3 functions as an integral component of mitochondrial complex I (NADH:ubiquinone oxidoreductase), which catalyzes the first step in the electron transport chain of oxidative phosphorylation . This complex facilitates the transfer of electrons from NADH to ubiquinone while simultaneously pumping protons across the inner mitochondrial membrane, thereby contributing to the generation of the proton gradient necessary for ATP synthesis .

The specific function of the ND3 subunit within complex I is not fully elucidated, though structural analyses and sequence alignments suggest it may play a critical role in stabilizing the ubiquinone binding site . This functional role positions MT-ND3 as a key determinant of electron transport efficiency and, consequently, cellular energy production.

Mitochondrial Genomic Context

The MT-ND3 gene is encoded by the mitochondrial genome and is subject to precise transcriptional regulation . Recent advanced annotation methodologies have provided insights into the transcriptional architecture of mitochondrial genomes across various primate species, including precise identification of transcription initiation and termination sites . These annotations have revealed conserved regulatory elements that influence MT-ND3 expression within the broader context of mitochondrial gene regulation.

Pathogenic Mutations and Disease Associations

Mutations in the MT-ND3 gene have been implicated in various human pathologies, providing valuable insights into the clinical significance of this protein. A notable example is the T10158C mutation, which has been associated with Leigh syndrome, a severe neurometabolic disorder characterized by progressive neurodegeneration . This mutation results in a Ser34Pro substitution, which may destabilize the ubiquinone binding site and disrupt electron transport, leading to reduced ATP production and increased generation of reactive oxygen species .

Beyond Leigh syndrome, polymorphisms in MT-ND3 have been associated with various conditions, including:

  1. Parkinson's disease

  2. Type 2 diabetes mellitus

  3. Breast cancer

  4. Esophageal cancer

  5. Potential links to gastric cancer risk

These associations underscore the critical importance of MT-ND3 in maintaining mitochondrial function and cellular homeostasis, with implications for understanding disease mechanisms and identifying potential therapeutic targets.

Comparative Analysis with Human MT-ND3

Comparative studies between Pongo pygmaeus MT-ND3 and its human counterpart provide valuable evolutionary insights and may inform understanding of species-specific susceptibilities to mitochondrial disorders. The high degree of conservation across primate MT-ND3 sequences reflects the essential nature of this protein in cellular respiration and energy production.

Recent precise annotations of mitochondrial genomes across human, chimpanzee, rhesus macaque, and mouse have revealed conserved sequence blocks and regulatory elements that influence MT-ND3 expression . These comparative analyses facilitate understanding of the evolutionary constraints acting on mitochondrial genes and may inform interpretations of pathogenic mutations.

Experimental Applications

Recombinant Pongo pygmaeus MT-ND3 serves as a valuable research tool across various experimental contexts, including:

  1. Structural studies of mitochondrial complex I

  2. Functional analyses of electron transport mechanisms

  3. Investigation of evolutionary relationships across primate mitochondrial genomes

  4. Development and validation of antibodies for mitochondrial research

  5. Comparative studies of mitochondrial protein function across species

The availability of high-purity recombinant protein facilitates these applications, providing researchers with standardized materials for investigating mitochondrial biology and related pathologies.

Analytical Methodologies

Various analytical techniques are employed in MT-ND3 research, including:

  1. Enzyme-linked immunosorbent assay (ELISA) for protein quantification and interaction studies

  2. SDS-PAGE for purity assessment and molecular weight determination

  3. Western blotting for specific detection in complex biological samples

  4. Mass spectrometry for structural characterization and post-translational modification analysis

  5. Functional assays measuring electron transport and NADH dehydrogenase activity

These methodologies collectively enable comprehensive characterization of MT-ND3 properties and functions, contributing to broader understanding of mitochondrial biology.

Emerging Areas of Investigation

Several promising research directions are emerging in the study of MT-ND3 and related mitochondrial proteins:

  1. Elucidation of the precise structural role of MT-ND3 within complex I through advanced cryo-electron microscopy

  2. Investigation of post-translational modifications that may regulate MT-ND3 function

  3. Comprehensive mapping of disease-associated mutations and their functional consequences

  4. Development of targeted therapies for mitochondrial disorders involving MT-ND3 dysfunction

  5. Exploration of species-specific variations in MT-ND3 structure and function across primates

These research directions may yield valuable insights into mitochondrial biology and potentially inform therapeutic strategies for mitochondrial disorders.

Technological Advances

Advanced technologies are increasingly applied to MT-ND3 research, including:

  1. CRISPR-Cas9 gene editing for creating cellular models of MT-ND3 mutations

  2. Single-cell transcriptomics to analyze MT-ND3 expression patterns

  3. Proteomics approaches to identify MT-ND3 interaction partners

  4. Computational modeling of complex I structure and function

  5. High-throughput screening for compounds that modulate MT-ND3 activity

These technological advances promise to accelerate understanding of MT-ND3 function and its role in mitochondrial biology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you require a specific tag type, please inform us. We will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MNFVLALTINTLLALLLMILTFWLPQLNPYMEKSDPYECGFDPAYPARIPFSMKFFLVAI TFLLFDLEIALLLPLPWALQTTNLPLMTTSSLMLIIILALGLTYEWSQKGLDWTE
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This function is essential for the catalytic activity of Complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.