Recombinant Pongo pygmaeus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what is its biological significance?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein encoded by the mitochondrial genome that functions as an essential component of mitochondrial complex I (NADH:ubiquinone oxidoreductase). This complex is embedded in the inner mitochondrial membrane and plays a crucial role in the first step of the electron transport chain during oxidative phosphorylation. Specifically, complex I transfers electrons from NADH to ubiquinone, a process necessary for generating the proton gradient that drives ATP synthesis . The protein's biological significance lies in its contribution to cellular energy production, making it vital for high-energy demanding tissues such as muscle and nervous system.

What is the molecular structure and characteristics of Pongo pygmaeus MT-ND4L?

Pongo pygmaeus MT-ND4L is a relatively small protein consisting of 98 amino acids. Its amino acid sequence is: MPLIYMNITLAFTMSLLGMLVYRSHLMSSLLCLEGMMLSLFIMITLMTNTHSLLANIMP ITMLVFAACEAAVGLALLASISNTYGLDY VNNLNLLQC . This highly hydrophobic protein is embedded in the inner mitochondrial membrane as part of complex I. It has UniProt accession number P61796 and functions with the enzyme classification EC 1.6.5.3 . As a membrane protein, it contains multiple transmembrane domains that anchor it within the lipid bilayer of the inner mitochondrial membrane.

How is recombinant Pongo pygmaeus MT-ND4L typically stored and what precautions should be taken for its handling?

Recombinant Pongo pygmaeus MT-ND4L should be stored at -20°C for regular use or -80°C for extended storage . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which helps maintain stability during freeze-thaw cycles . For handling:

• Avoid repeated freeze-thaw cycles as they can degrade protein quality

• Store working aliquots at 4°C for up to one week

• For reconstitution of lyophilized protein, briefly centrifuge the vial before opening

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add 5-50% glycerol (final concentration) when aliquoting for long-term storage

The shelf life is typically 6 months for liquid form and 12 months for lyophilized form when stored properly at -20°C/-80°C .

What role does MT-ND4L play in the assembly and function of mitochondrial complex I?

MT-ND4L serves as a critical structural component that enables the proper assembly of the 950-kDa mitochondrial complex I. Research demonstrates that the absence of ND4L polypeptides prevents the assembly of the whole complex I and suppresses enzyme activity . Functionally, MT-ND4L contributes to the proton-pumping mechanism of complex I. As part of this massive enzyme complex, it participates in creating an unequal electrical charge on either side of the inner mitochondrial membrane through electron transfer. This electrochemical gradient is essential for ATP production through oxidative phosphorylation . The protein's highly hydrophobic nature allows it to remain embedded in the membrane where it likely forms part of the proton channel.

How does the amino acid sequence of Pongo pygmaeus MT-ND4L compare with that of other primates and mammals?

While the search results don't provide a direct comparison between Pongo pygmaeus MT-ND4L and other primates, we can observe similarities in structure and function across mammals. For example, the MT-ND4L from Lama guanicoe pacos (alpaca) is also 98 amino acids long with a similar amino acid sequence: MSMVYMNIMLAFTMSLIGLLMYRSHLMSSLLCLEGMMLSLFVMASLMILSTHFTLASMMP IILLVFAACEAALGLALLVMISNTYGTDYVQNLNLLQC . This suggests a high degree of conservation across mammalian species, reflecting the essential nature of this protein for mitochondrial function. Comparative studies would typically show higher sequence homology among closely related primates than between primates and other mammalian orders, with critical functional domains being the most conserved regions.

What interactions does MT-ND4L have with other subunits of complex I, and how do these interactions affect enzyme function?

MT-ND4L interacts with multiple subunits within mitochondrial complex I to form a functional enzyme. Research indicates that MT-ND4L has close spatial and functional relationships with other membrane-embedded subunits, particularly those encoded by the mitochondrial genome. These interactions are critical for maintaining the structural integrity of the complex and its proton-pumping activity. When MT-ND4L is absent, the entire 950-kDa complex fails to assemble properly, and enzyme activity is suppressed . This indicates that MT-ND4L likely occupies a position within the complex that is essential for the correct folding and assembly of other subunits. The protein's hydrophobic regions interact with the lipid bilayer and neighboring protein subunits, contributing to the stability of the complex within the inner mitochondrial membrane.

What expression systems are most effective for producing recombinant Pongo pygmaeus MT-ND4L?

Based on available research data, several expression systems have been employed for producing recombinant MT-ND4L, each with different advantages:

• E. coli expression system: Used for producing recombinant MT-ND4L from Lama guanicoe pacos (alpaca) . This system offers high yield and cost-effectiveness but may require optimization for proper folding of membrane proteins.

• Yeast expression system: Employed for producing recombinant proteins from Pongo pygmaeus, including MT-ND4 (a related protein) . Yeast systems often provide better post-translational modifications and membrane protein folding than bacterial systems.

For optimal expression of Pongo pygmaeus MT-ND4L, researchers should consider:

• Using codon optimization for the host expression system

• Incorporating solubility tags (His-tag is commonly used)

• Employing specialized strains designed for membrane protein expression

• Optimizing growth temperature and induction conditions

The specific expression conditions must be empirically determined for each recombinant protein preparation to maximize yield and proper folding.

What purification strategies yield the highest purity and activity for recombinant MT-ND4L?

Purification of recombinant MT-ND4L typically involves a multi-step process designed to isolate this highly hydrophobic membrane protein while maintaining its structural integrity:

• Initial extraction using mild detergents to solubilize the membrane-embedded protein

• Affinity chromatography using the attached tag (most commonly His-tag)

• Size-exclusion chromatography to separate the target protein from aggregates and other contaminants

• Ion-exchange chromatography for further purification if needed

To maintain protein activity during purification:

• Use buffers containing glycerol (typically 50%) to stabilize the protein

• Maintain appropriate pH (typically Tris-based buffers)

• Include protease inhibitors to prevent degradation

• Perform purification steps at 4°C when possible

The final product should achieve >85-90% purity as determined by SDS-PAGE , with activity assays performed to confirm functional integrity.

What are the most sensitive and reliable methods for assessing MT-ND4L function in experimental settings?

Several complementary approaches can be used to assess MT-ND4L function:

• Complex I activity assays:

  • NADH:ubiquinone oxidoreductase activity measurement using spectrophotometric methods

  • Oxygen consumption rate measurements in mitochondrial preparations

  • Membrane potential assays using fluorescent probes

• Structural integrity assessment:

  • Blue native PAGE to determine if the protein is properly incorporated into the 950-kDa complex I

  • Crosslinking studies to identify interaction partners within the complex

• Functional complementation:

  • Rescue experiments in systems lacking endogenous MT-ND4L

  • Measuring restoration of complex I assembly and activity

• Site-directed mutagenesis:

  • Systematic mutation of key residues followed by functional assays to determine their importance

  • Comparison with known disease-causing mutations (e.g., Val65Ala)

These methods should be used in combination to provide a comprehensive understanding of MT-ND4L function and how experimental manipulations affect its role in complex I.

How can recombinant MT-ND4L be used to study mitochondrial diseases associated with complex I deficiency?

Recombinant MT-ND4L serves as a valuable tool for investigating mitochondrial diseases through several research approaches:

• In vitro reconstitution studies:

  • Reconstituting complex I with wild-type or mutant MT-ND4L to assess functional consequences

  • Studying how specific mutations affect assembly, stability, and activity of complex I

• Structure-function analysis:

  • Using purified recombinant protein for structural studies (e.g., cryo-EM, crystallography)

  • Mapping disease-causing mutations onto structural models to understand their impact

• Protein-protein interaction studies:

  • Identifying interaction partners that may be affected in disease states

  • Determining how mutations disrupt normal protein interactions within complex I

• Development of therapeutic approaches:

  • Testing compounds that might stabilize mutant MT-ND4L

  • Developing strategies for delivering functional MT-ND4L to affected tissues

Specifically for Leber hereditary optic neuropathy, researchers can use recombinant MT-ND4L with the Val65Ala mutation to investigate how this amino acid change affects protein function and complex I assembly .

What insights can comparative studies of MT-ND4L across species provide for understanding adaptation to different environmental conditions?

Comparative studies of MT-ND4L across species offer valuable insights into evolutionary adaptations to different environments, particularly regarding energy metabolism:

• High-altitude adaptation:
  Research on MT-ND4L genetic diversity in Tibetan yaks and cattle has revealed specific haplotypes (particularly Ha1) that show positive associations with high-altitude adaptability . These genetic variations likely confer advantages for mitochondrial function under hypoxic conditions.

• Comparative data table of MT-ND4L haplotypes and high-altitude adaptation:

• Species-specific adaptations:
  Comparing MT-ND4L sequences from Pongo pygmaeus (forest-dwelling) with high-altitude adapted species could reveal amino acid substitutions that reflect different environmental pressures on energy metabolism.

• Functional consequences:
  Recombinant proteins representing different haplotypes can be tested for:

  • Oxygen affinity differences

  • Efficiency of electron transfer

  • ROS production under various oxygen tensions

  • Stability at different temperatures

These studies contribute to our understanding of how mitochondrial genes evolve to optimize energy production in different ecological niches.

How do mutations in MT-ND4L affect the assembly and function of mitochondrial complex I, and what are the implications for cellular bioenergetics?

Mutations in MT-ND4L can have profound effects on complex I assembly and function, with cascading consequences for cellular bioenergetics:

• Assembly defects:
  Research demonstrates that the absence of ND4L polypeptides prevents the assembly of the 950-kDa whole complex I . Specific mutations may similarly disrupt assembly by preventing proper folding or interaction with other subunits.

• Functional consequences:

  • Reduced NADH:ubiquinone oxidoreductase activity

  • Decreased proton pumping across the inner mitochondrial membrane

  • Lower ATP production capacity

  • Potential increase in reactive oxygen species (ROS) production

• Disease-specific mutations:
  The Val65Ala mutation (T10663C) in MT-ND4L has been identified in families with Leber hereditary optic neuropathy . This mutation likely affects a critical functional domain of the protein.

• Cellular adaptations:
  In response to MT-ND4L mutations, cells may exhibit:

  • Increased mitochondrial biogenesis to compensate for reduced complex I activity

  • Metabolic reprogramming to rely more on glycolysis

  • Altered mitochondrial dynamics (fusion/fission)

  • Activation of mitophagy to remove dysfunctional mitochondria

Understanding these mechanisms is crucial for developing potential therapeutic strategies for mitochondrial disorders associated with MT-ND4L dysfunction.

What is the significance of the Val65Ala mutation in MT-ND4L for Leber hereditary optic neuropathy, and how does it affect protein function?

The Val65Ala mutation (T10663C) in MT-ND4L has been identified in several families with Leber hereditary optic neuropathy (LHON) . This mutation changes a single protein building block (amino acid) in the NADH dehydrogenase 4L protein, specifically replacing the hydrophobic amino acid valine with the smaller alanine at position 65.

The significance of this mutation lies in several aspects:

• Functional impact:

  • The mutation likely affects the protein's interaction with other complex I subunits

  • It may alter the hydrophobic characteristics of a transmembrane domain

  • The change could affect electron transfer efficiency or proton pumping

• Tissue specificity:

  • Despite MT-ND4L being expressed in all tissues with mitochondria, the Val65Ala mutation predominantly affects retinal ganglion cells and the optic nerve

  • This tissue-specific effect may relate to the high energy demands of these cells

• Biochemical consequences:

  • Reduced complex I activity

  • Increased ROS production

  • Compromised ATP synthesis

  • Potential triggering of apoptotic pathways in retinal ganglion cells

While researchers have not fully determined the exact mechanism by which this mutation leads to vision loss , the location of the mutation in a highly conserved region suggests it disrupts a functionally critical domain of the protein.

What other genetic variations in MT-ND4L have been identified across populations, and what is their functional significance?

Research on genetic variations in MT-ND4L has revealed several significant polymorphisms across populations:

• High-altitude adaptation-related variations:
  Studies comparing Tibetan yaks, Tibetan cattle, and Holstein-Friesian cattle have identified specific haplotypes in MT-ND4L that show significant associations with high-altitude adaptability :

  Haplotype	Frequency in High-Altitude Animals	Association	P-value
  Ha1	Higher in Tibetan yaks/cattle	Positive	p < 0.0017
  Ha3	Lower in Tibetan yaks/cattle	Negative	p < 0.0017

• Functional significance:

  • Positive-associated haplotypes likely confer advantages for mitochondrial function under hypoxic conditions

  • These variations may improve oxygen utilization efficiency

  • Adaptations could include modified electron transfer kinetics or altered ROS production under low oxygen

• Conservation analysis:

  • Comparing MT-ND4L sequences across species reveals highly conserved regions that are likely critical for function

  • Variations in less conserved regions may represent adaptations to specific environmental conditions

  • Disease-associated mutations typically occur in highly conserved regions

These population-level genetic variations provide valuable insights into both pathological changes and adaptive evolution of mitochondrial function across different environmental conditions.

How do MT-ND4L variations contribute to adaptation to hypoxic environments, and what molecular mechanisms are involved?

MT-ND4L variations play a significant role in adaptation to hypoxic environments through several molecular mechanisms:

• Research findings in high-altitude animals:
  Studies have shown that specific haplotypes in MT-ND4L (particularly Ha1) are positively associated with high-altitude adaptability in Tibetan yaks and cattle . These animals have evolved to thrive in the hypoxic environment of the Qinghai-Tibetan Plateau, where oxygen levels are significantly lower than at sea level.

• Molecular mechanisms:

  • Optimized electron transfer efficiency: Adaptive variations may allow complex I to function more efficiently under low oxygen conditions

  • Reduced ROS production: Beneficial variants might decrease harmful reactive oxygen species generation during electron transport under hypoxia

  • Enhanced proton pumping: Some variants may improve the proton gradient generation needed for ATP synthesis

  • Structural stability: Certain amino acid changes could improve protein stability under hypoxic stress

• Comparative advantage:
  The research demonstrates that cattle from other regions are susceptible to hypertension and heart failure when exposed to high-altitude environments , while Tibetan cattle with adaptive MT-ND4L variants avoid these problems.

• Evolutionary significance:
  These adaptations represent natural selection acting on mitochondrial genes to optimize energy production in challenging environments, providing a compelling example of adaptive evolution at the molecular level.

Understanding these mechanisms has implications beyond evolutionary biology, potentially informing treatments for hypoxia-related human diseases and conditions.

What are the major challenges in working with recombinant MT-ND4L, and how can they be addressed?

Working with recombinant MT-ND4L presents several significant challenges due to its nature as a small, hydrophobic membrane protein:

• Expression challenges:

  • Poor expression levels in conventional systems

  • Protein misfolding and aggregation

  • Toxicity to host cells

  Solutions:

  • Use specialized expression systems designed for membrane proteins

  • Optimize codons for the host organism

  • Express at lower temperatures (16-18°C)

  • Use fusion tags that enhance solubility

  • Consider cell-free expression systems for toxic proteins

• Purification difficulties:

  • Low solubility in aqueous buffers

  • Tendency to aggregate during purification

  • Loss of native conformation when extracted from membranes

  Solutions:

  • Use appropriate detergents or lipid nanodiscs to maintain membrane environment

  • Include stabilizing agents like glycerol (50%) in buffers

  • Employ mild purification conditions

  • Consider on-column refolding techniques

• Storage and stability issues:

  • Limited shelf-life

  • Activity loss during freeze-thaw cycles

  Solutions:

  • Store at -20°C/-80°C in appropriate buffer conditions

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Add 5-50% glycerol for long-term storage

• Functional assessment challenges:

  • Difficulty reconstituting in functional form

  • Complex enzymatic assays requiring intact complex I

  Solutions:

  • Use native membrane preparations for functional studies

  • Employ complementation assays in cell lines lacking the protein

  • Develop simplified assays for specific aspects of function

How can researchers ensure the recombinant MT-ND4L protein maintains its native structure and function during experiments?

Ensuring recombinant MT-ND4L maintains its native structure and function requires careful attention to several key factors:

• Membrane environment preservation:

  • Use appropriate detergents that mimic the lipid bilayer

  • Consider reconstitution into liposomes or nanodiscs with defined lipid composition

  • Maintain pH and ionic conditions similar to the mitochondrial inner membrane

• Quality control assessments:

  • Perform circular dichroism (CD) spectroscopy to verify secondary structure

  • Use limited proteolysis to assess proper folding

  • Employ analytical ultracentrifugation to verify monodispersity

  • Conduct functional assays to confirm activity

• Storage and handling protocols:

  • Store in Tris-based buffer with 50% glycerol at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Keep working aliquots at 4°C for no more than one week

  • Use fresh preparations for critical experiments

• Experimental design considerations:

  • Include positive controls with known activity

  • Perform experiments under conditions that minimize oxidative damage

  • Consider the native complex I environment when designing interaction studies

  • Validate results with complementary approaches

By implementing these strategies, researchers can significantly improve the likelihood of working with properly folded and functionally relevant recombinant MT-ND4L protein.

What are the best practices for designing experiments to study MT-ND4L interactions with other complex I subunits?

Designing robust experiments to study MT-ND4L interactions with other complex I subunits requires sophisticated approaches that account for the challenges of membrane protein biochemistry:

• Protein-protein interaction methods:

  • Crosslinking studies with MS analysis to identify interaction partners

  • Co-immunoprecipitation with antibodies against MT-ND4L or potential partners

  • Blue native PAGE to assess incorporation into the full 950-kDa complex

  • FRET-based assays for detecting proximity between labeled subunits

  • Surface plasmon resonance for quantitative binding kinetics

• Reconstitution approaches:

  • In vitro reconstitution of partial or complete complex I with purified components

  • Sequential addition of components to determine assembly order

  • Complementation studies in cell lines lacking specific subunits

  • Creation of chimeric proteins to map interaction domains

• Structural biology techniques:

  • Cryo-EM analysis of complex I with and without MT-ND4L

  • Hydrogen-deuterium exchange MS to identify protected regions

  • Site-directed spin labeling coupled with EPR spectroscopy

  • Computational modeling based on available structural data

• Experimental controls and validation:

  • Include known interaction partners as positive controls

  • Use unrelated membrane proteins as negative controls

  • Validate interactions through multiple independent techniques

  • Confirm functional relevance through activity assays

• Mutagenesis strategy:

  • Create systematic alanine scanning mutations across MT-ND4L

  • Target conserved residues identified through evolutionary analysis

  • Focus on disease-associated mutations like Val65Ala

  • Design compensatory mutations in proposed interaction partners

These approaches, used in combination, provide complementary data that can reveal the network of interactions between MT-ND4L and other complex I components.

Future Research Directions

Future research on MT-ND4L should focus on:

• Detailed structural studies to understand its precise role within complex I

• Comprehensive mapping of interactions with other complex subunits

• Development of improved expression systems for recombinant production

• Exploration of additional disease-associated mutations and their mechanisms

• Comparative studies across diverse species to further understand evolutionary adaptations

• Investigation of potential therapeutic approaches targeting MT-ND4L-related disorders