Recombinant Pongo pygmaeus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant MT-ND6 is utilized in:

  • Functional Studies: Investigating mutations linked to mitochondrial disorders (e.g., Leber’s hereditary optic neuropathy) .

  • Structural Biology: Mapping ubiquinone-binding regions via cryo-EM .

  • Evolutionary Research: Analyzing positive selection in primate Complex I subunits. For example, a Y61C mutation in orangutan MT-ND6 correlates with enhanced proton-pumping efficiency .

Evolutionary Significance

Comparative genomic studies reveal that MT-ND6 in Pongo pygmaeus underwent adaptive selection during primate evolution, particularly in residues affecting Complex I assembly and activity . Key findings include:

  • Positive Selection: Detected in the NDUFA1 subunit (interacts with MT-ND6) post-orangutan divergence .

  • Conserved Mutations: Orangutan-specific substitutions (e.g., Y61C) alter conserved physicochemical properties, potentially influencing mitochondrial efficiency .

Quality Control and Validation

  • Purity: Validated by SDS-PAGE and mass spectrometry .

  • Activity: Confirmed via NADH oxidation assays (ubiquinone reduction rates) .

  • Stability: Retains functionality for ≥6 months at -80°C when aliquoted .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please specify your needs in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-174
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MTYALFLLSVILVMGFVGFSSKPSPIYGGLVLIISGAVGCAVILNCGGGYMGLVVFLVYL GGMMVVFGYTTAMAIEEYPEAWGSGAEVLVSVLVGLVMEVGLVLWVKECDGVVVAVNFNS VGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYVVIEIARGN
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It is essential for the catalytic activity and assembly of Complex I.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of the MT-ND6 subunit in mitochondrial Complex I?

The MT-ND6 subunit is one of seven mitochondrial DNA-encoded components of Complex I (NADH-ubiquinone oxidoreductase), which plays a critical role in oxidative phosphorylation. It facilitates electron transfer from NADH to ubiquinone while coupling this reaction to proton translocation across the inner mitochondrial membrane, thereby contributing to the generation of a proton motive force essential for ATP synthesis . Studies have shown that mutations in MT-ND6 can impair oxidative phosphorylation, leading to reduced respiratory efficiency and associated pathologies . For example, frameshift mutations in MT-ND6 result in defective assembly of Complex I subunits and diminished NADH:Q1 oxidoreductase activity .

How can recombinant MT-ND6 proteins be utilized in functional studies?

Recombinant MT-ND6 proteins are valuable tools for elucidating the structure-function relationship of Complex I. These proteins can be expressed in systems such as E. coli, purified using affinity tags like His or Strep, and reconstituted into artificial membranes or liposomes for biochemical assays . Functional studies often involve assessing electron transfer activity, proton translocation efficiency, or interaction with other subunits using techniques such as spectrophotometry, cryo-electron microscopy, and molecular dynamics simulations . Additionally, recombinant proteins allow researchers to study the effects of specific mutations on enzymatic activity and structural integrity.

What experimental approaches are used to analyze the impact of MT-ND6 mutations on Complex I function?

To investigate the effects of MT-ND6 mutations, researchers commonly employ a combination of genetic, biochemical, and computational methods. Mutant cell lines with homoplasmic or heteroplasmic mtDNA alterations can be generated using cytoplasmic hybridization techniques (cybrid formation) . Biochemical assays such as NADH:Q1 oxidoreductase activity measurements and oxygen consumption rates provide insights into functional deficits . Structural studies using X-ray crystallography or cryo-electron microscopy reveal changes in subunit assembly or conformational dynamics . Computational modeling and molecular dynamics simulations are also employed to predict how mutations affect protein stability and interactions within Complex I.

How does recombinant MT-ND6 protein contribute to understanding disease mechanisms?

Recombinant MT-ND6 protein enables detailed investigations into the pathogenic mechanisms underlying mitochondrial diseases linked to Complex I dysfunction. For example, researchers can introduce disease-associated mutations into the recombinant protein and study their impact on enzymatic activity, stability, or electron transfer efficiency . Functional assays with mutant proteins often reveal impaired proton translocation or disrupted electron flow, shedding light on how these defects contribute to clinical phenotypes such as Leigh syndrome or MELAS (mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes) .

How does the absence of MT-ND6 affect cellular metabolism?

The absence of MT-ND6 disrupts the assembly of Complex I subunits encoded by mitochondrial DNA, leading to severe reductions in malate/glutamate-dependent respiration and NADH:Q1 oxidoreductase activity . This metabolic impairment forces cells to rely on glycolysis for ATP production instead of oxidative phosphorylation, as evidenced by their inability to grow in galactose-containing media . Such metabolic shifts are characteristic of mitochondrial dysfunction and have been implicated in various neurodegenerative diseases and metabolic disorders.

What methods are available for studying protein-protein interactions involving MT-ND6?

Protein-protein interactions involving MT-ND6 can be studied using techniques such as co-immunoprecipitation (Co-IP), cross-linking mass spectrometry (XL-MS), Förster resonance energy transfer (FRET), and proximity labeling methods like BioID . Recombinant MT-ND6 tagged with affinity labels enables its isolation alongside interacting partners from mitochondrial extracts . Structural studies using cryo-electron microscopy further elucidate interaction interfaces within Complex I .

How can computational modeling aid in understanding MT-ND6 function?

Computational modeling provides valuable insights into the structure-function relationship of MT-ND6 by simulating its dynamics within Complex I under various conditions. Molecular dynamics simulations predict how mutations affect protein stability, folding pathways, or interaction with other subunits . Docking studies help identify potential binding sites for inhibitors or substrates on MT-ND6 . Computational approaches also complement experimental data by validating hypotheses about electron transfer mechanisms or proton translocation pathways.

What are the implications of studying MT-ND6 from different species?

Comparative studies of MT-ND6 across species like humans, mice, and Pongo pygmaeus provide insights into conserved structural features and functional roles within Complex I . Differences in amino acid sequences may reflect adaptations to specific metabolic demands or environmental conditions. Such comparisons also aid in identifying critical residues involved in enzymatic activity or subunit assembly.

How is oxidative phosphorylation affected by defects in MT-ND6?

Defects in MT-ND6 impair the coupling between NADH oxidation and proton translocation within Complex I, reducing ATP synthesis efficiency during oxidative phosphorylation . These defects disrupt the electrochemical gradient required for energy production and ion transport across the inner mitochondrial membrane . Consequently, cells exhibit reduced growth rates under oxidative conditions and increased reliance on anaerobic metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.